Conserved Protein Domain Family
FAM184

?
pfam15665: FAM184 
Family with sequence similarity 184, A and B
The function of FAM184 is not known.
Statistics
?
PSSM-Id: 317968
View PSSM: pfam15665
Aligned: 14 rows
Threshold Bit Score: 124.392
Threshold Setting Gi: 301106631
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 301106631   29 VIFQLNTRNEDYQAEAEYTRTAHTAELQRLTQDAADTMRTLQGK------LQTQAATAAQRERQYVSERQKYMNEAQQQQ 102
gi 972952644   59 VIYALNTKNDEHEAAIQTLKEAHEEEVQQILSETREKILQYKSKisdemdLKRRIQSLEESMELHERMKRQALAEFETYR 138
gi 556990546   60 VIYALNTKNDEHEAAIQALKDAHEEEIQQILAETREKILQYKTKveeegdLKRRIHFLEESLEQHERVKRQALAEFEVYK 139
gi 301605044   61 VIYALNTKNDEHESGIQAIKEAHEEEIQKILAETHEKILLYKNKvseetdLKHKIKALEESLEEHKKMKHHALTEFEVYK 140
gi 459176120   52 VIYALNTKNDEHEAAMNALKDAHEEETQQILAETAAKIQQFRIKigndldLRKKIQNLEECIATFELEKRKAMMDVESYK 131
gi 390351666   48 VIYALNTKNDEHEAMVQSLKDSHEEELQQLMGETKLKITVYQSKlgkeleLQQRVNKLEAEASDFERQKRESHADFSEFK 127
gi 405974241   48 VIYALNTKNDEHEAVVQTLKEQHEEQIQQLLSETREKILKIKQKidndsdHKHTISNLQNCVAEHEKHKKEALSKFEGYK 127
gi 260829657   51 VIYALNTKNDEHELEVSRIKEAHKDELQQLMAEMQGKIELYRSKigseldMRRQIESLESTISEHERIKRQAITEFEIFK 130
gi 972964205   48 VIYALNTKCDEHDSSLQALKEAHQEEIEQIMEETQEKILKYKSQgeeetdLHQRLQAMEETLEQYERLKDEALTDFETYR 127
gi 768958067   57 VIYALNTKNDEHEEEIESLKEAHEDEVQHIVTETRDKIMQYKSKmvdeadLRRRLANLEESVELHEHMKRQALAEFEMYR 136
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 301106631  103 RRSQAGRAAAEEAFRAKVTEFETQVLEAQRAFDERIEQLTQLALEKEaqrvlssQEESVAlearLEEMRLKHADEVERLV 182
gi 972952644  139 QRVEDMQLCTEAQHTQRVVTMSREVEEMRRNFEEKLRSFAQVQAQFE-------QEKRQA----LEDLRAAHRQEIQELL 207
gi 556990546  140 HRVEDMQLCMEAQHTQRVVTMSREVEEIRRNFEEKLRSFVQQQAQSE-------KEKRAV----LEDLKAAHKLEIQEFL 208
gi 301605044  141 HRVEDMQLCAEAQHVQRIVTMSREVEEMRKKFDERIHNFMQIQVQFE-------KDKRSA----LDDLRTS-RLEIQELL 208
gi 459176120  132 DDMARQTIKQGKSHQDTVQALSRELMEAKNAFEQRVVDFESNMSNMD-------RERNKN----LDSVSMEYRKEISNLQ 200
gi 390351666  128 RNSEVREGNLRAEHSQKLLGLSQDLLGVKRDFEDRLRQFGDGKEKLD-------QEKVAA----LEGLRAKHREEIEAIH 196
gi 405974241  128 RQAEERENKLKTEHSQKYLELSQEVLAAKRHFEEQLSKFELWRKEAD-------SEKEKA----LEEQKQIHTKEIDELR 196
gi 260829657  131 QNSEEKERHLRSEHSQQLANLARQLETAQKEFQAQLKSFQQQQQAAI-------ADKETS----LQELRSVYQRQVDEIL 199
gi 972964205  128 RQTEERELKSQTEHAERIMALSTEMVDLKKDFEGKLQALAGLKEQLE-------QEKEKA----QAELERT-NQESQSLQ 195
gi 768958067  137 QRMEDSQLCTEAQHTQRVVSMSREVEEMRRDFEEKLRAFSQAQTQFE-------ADKRRA----LEELRAIHRQEVDDLL 205
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 301106631  183 TTSNAKHNKMLAEQLRAQDALKADLVSAK---LDFDKQKQEVIAELEQQRLKQEMSAKTSFD 241
gi 972952644  208 RSHQSQNANYSKDQEKLSQLHKAEVDSLServEELKQDKKRLVEEYEAKLNKAQAFYERELD 269
gi 556990546  209 MTQQNQNENVTHDQQELEQLHRAEVEELSnklEDLKLERKQIVEEYETKLGKAQAFYEHELE 270
gi 301605044  209 KAQHNQNATLNKGQETLLEMHRLQVEDLNkkiEDMRLERKRLVEDYEAKLTKAQAFYEHEME 270
gi 459176120  201 QRLKDQTSSFATEKEVIASTHAQSLAQYQqevMSVRQEMKKIMEENDDKMEKCKNFYERELE 262
gi 390351666  197 KAHQAQQSGSSSEVAELTRRHEAEVTRLKqecESLSSEKSHLVEDYESKLEKLKAFHEREIS 258
gi 405974241  197 DFFRSQNNDWLNECAKIEDKYKAELEGLRaqsETLNSEKQKLTEDYESKLAKAKAFYEKELE 258
gi 260829657  200 NKQRTQTSELAGEKEKVQQEMEQHILKLRqdcENLEAQNRQVAHEYEDKISKQKALFEKELl 261
gi 972964205  196 DECRELRRNSMGERSRLEEMCQTRTRALReelERLRAERLRLAEEFEQKVSSLKAAHQEEQE 257
gi 768958067  206 NKHQNQSASSTEDQEKLAELHRQEVDALMervEELTKDKVRLVEEYEAKLAKAQECYERELE 267
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap