Conserved Protein Domain Family
Spem1

?
pfam15670: Spem1 
Spermatid maturation protein 1
Spem1 is a family of mammalian proteins. Proteins are exclusively expressed in the cytoplasm of the last three steps of spermiogenesis in the mouse testis, and male mice deficient in Spem1 are completely infertile because of deformed sperm.
Statistics
?
PSSM-Id: 317973
View PSSM: pfam15670
Aligned: 14 rows
Threshold Bit Score: 176.131
Threshold Setting Gi: 821482519
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 261260060   1 MENQLWHNTVRCCNQYQESPHDAEDILLLLLGLIVLVNIGINVATMMWHGLQNALDKMIDWATQKNEI-QASESPPSGPP 79
gi 81884365    1 MENQLWQSTLGCCSQYQESPQDAENILFLLLGLIILVNISINVTTVIWHGLQNAIDKMFSRMHQKTAEvQVTECPPKEPQ 80
gi 344237797   1 MENHLWQGTLGGCNQYQESPQDPEDILFLLLGLIILVHISINVTTVMWHGLQNALDKMICWMNQKTNEvQATERPPKEPT 80
gi 348560842   1 MENQPWRDTLGCCSQHQENPQDPEDILFLLLGLIILVNISINMATVMWHGLQNALDKTIYWINQKSEV-WASDCSAKDPP 79
gi 512991424   1 MENQLWHDTLGFCSQYQERPQDAEDILFLLLGLIILVNISINMATVMWNGLQNALDKMIYWINQKNEV-QASECSSKYPP 79
gi 291405145   1 MENQLWHDNLGCYSECQASPQDAEEILFVLLGLIILVNISINVTTAMWQGLQNILDRMISCIIPKDEV-QPSESPPKDPP 79
gi 927197907   1 MENQLWHDHLGCCHQYQESTQNAEDLLLLLLGLVVLVNIGINMATVMWQGLQNVLDKIAHWTNDKNEVlQACERSPKYPP 80
gi 395836760   1 MENQLWHNSVGCCSQYQESPQDAEDILFLLLGLIILVNIGINMATVMWHGLQNALDKMMDCTNQKKDI-QAYESSPKSLP 79
gi 344290434   1 MEDQLWYDTLGCCNQYQESPQDTEDFLLLLLGLIILVNIGINMATVMWHRFQNALDKMICWINQKNDAfQACQNSPRDPC 80
gi 755787708   1 MENQLYYDSLGSCSPYQEAPQGANDLLLLLLGLVILVNIGINVVTAMWHGLQNALDKMIHWIHLKNEIlQASEGSPKDAP 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 261260060  80 -DKAQDVHIHCILDPVQVKMSRPTQYSSFS--------------------------CHHFSNHHSSSllr------cvRR 126
gi 81884365   81 pANVQDVHIHCVLDPVQVKMAQPTQCSSSS--------------------------THYFRKHSNDR-----------RS 123
gi 344237797  81 -ANVQDVHIHCILDPVQVKMAQPTPCSSSS--------------------------YHYLRKPYGSRr----------RR 123
gi 348560842  80 -AKAQDIHVHCTLDPVQVKMAPPTHSSASS--------------------------GQYPFNCHRRR-----------R- 120
gi 512991424  80 -AKAQDVHVHCILDPVQAKMARPTRYSSSS--------------------------SHYLLNGHSRR-----------RC 121
gi 291405145  80 -AKPQDVHIHCTLDPVKVKMTQPIHYSSSSchrfhnrrnsrnrtnsrgrrrsrrqgMPL--------------------- 137
gi 927197907  81 -AKAHDVHLHCTLDPVEVKMAQPTCYSSFS--------------------------YHHLCNRSRRRrr-------rrRS 126
gi 395836760  80 -AKAKDMQIHCILDPVQVKMTRPTQYSSSS--------------------------CHHPCKHRHSRrrsrsrsrcgsRS 132
gi 344290434  81 qAPARDIHIHCTLDPVEVKMAQSTCYSSSSyrlrncnsrrh--------------------------------------- 121
gi 755787708  81 -AKTQDVHIHCALDPVEVKMARPTCHRSSS--------------------------YRCLRSPRCSCrrhrr--cshrRG 131
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 261260060 127 RRRRHRRC----------RRRCCNHQQRPQNYRQIPHSHSVFRNPHRSQKMSQLHRVPFFDQEDPDSYLeeEDNLPFPYP 196
gi 81884365  124 RRRYCYPRgslqirqsnqQQSCHSRQQRLRNNRQFSHGYPPFRKQRQSHKASQTRPMPFFDLEDRDSLL--EDDQSCPHP 201
gi 344237797 124 RRRWSRYQqgshnrypqgRR---SHQQRFRNNRQFPHRYQLFRKQPQRYNTSQPRPLPYCDLEDQDPPL--DDDQSCP-- 196
gi 348560842 121 ------------------------YQPRPRNHKQFPRGFRIGHNQPYGCKTLKPRPVPFYDLEDQDPYVeeLEDSPFPVL 176
gi 512991424 122 RRRFHHHY----------------RQQKPQNHKQFPKGCPIFHNQPYGYKTSQPQPVPFFDLEDRDPYLeeLEDPSSPIL 185
gi 291405145 138 ----------------------CSHQQRPQNPRRFPRGRPVFRNQHHGYKVPKLRPKPFFDLEDRDSCLeeEEDLSFPHS 195
gi 927197907 127 RCRP--------------------HQWRPKTHRRFPYSRSVFRRPHGSHKMAQLRPVSSFDPEDLDSYLe-EEDLSPPRP 185
gi 395836760 133 RSRIHHR-----------RYRRCRPQQRTQNRRRFSHGRSGFCNQHHSHKMSQPRPMSYLDGEDQDPYLeeEDDMAFPYP 201
gi 344290434 122 --------------rnhrrrhpfshQQRPKNHRQFRHGCPVFRGLRGSHKMSHLRPMPSLDREDQDSYLedEDGLSFPQP 187
gi 755787708 132 RHPGHHRP--------------CSHQWGLRNHRHFPPNRSVFHSHCHNRKMSQLRPVPSFDEDNLDSCLe-EDDLSFPHP 196
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 261260060 197 KYP-RRGW-GGFYQRAGL-PSNVGLWGHQGGILASLPPPSLYLSPELRCMPKRVEARSELRLQSY 258
gi 81884365  202 KQP-RRSR-GGLYKPVRL-ASNAGLWGRQGGILASLPLPSLYLSPEMRRLPKRVEAKSELRLQGF 263
gi 344237797 197 ----HRSW-GGFYKPTSM-ASNVGLWGRKGGILASLPLPSIYLSPELRRLPKRVEAKSELRLQAF 255
gi 348560842 177 KYPhHRGR-GGLYQRKDV-PSIVGLWGRQGGILASLPPPSLYLSPELRRLPRRVQARSELRLQAY 239
gi 512991424 186 KYP-HRCK-GGVYQQMDV-PSIVGLWGHQGRNLASLPPPSLYSSPELRRLPKRVEAKSELRLQSY 247
gi 291405145 196 KYP-RRGW-GGFYPRMALpPSSVGLWGRQGGILASLPPPSLYLSPELRRLPKRVEAKSELRLQSY 258
gi 927197907 186 KYL-PGGWgGGLYPQMGL-PSNVGLWGRQGGILASLPPPSLYLSPELRRLPKRVEAKSELRLQSY 248
gi 395836760 202 KYP-RGGW-GGLYPRMGL-PSNVGLWGRRGGILASLPPPSLYLSPELRRMPKRVEAKSELRLQSY 263
gi 344290434 188 KYP-HGGW-GGLYPRLGL-PSNLGLWGRQGGILASLPPPSLYMSPELRRMPKRVEAKSELRMQSY 249
gi 755787708 197 KYP-RRGC-GGLYQPVGL-PSNLGLWGRQGGILASLPPPSLYLSPELRRMPKRVEAKSELRLQSY 258
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap