Conserved Protein Domain Family
CCDC23

?
pfam15674: CCDC23 
Coiled-coil domain-containing protein 23
This family of proteins is found in eukaryotes. Proteins in this family are typically between 66 and 78 amino acids in length. There are two completely conserved residues (K and E) that may be functionally important.
Statistics
?
PSSM-Id: 317977
View PSSM: pfam15674
Aligned: 7 rows
Threshold Bit Score: 57.2422
Threshold Setting Gi: 327289778
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|....*..
gi 94707502    6 RKEKSKVKEPAFRVEKAKQKSAQQELKQRQRAEIYALNRVMTELEQQQFDEFCKQMQ 62
gi 390360788 459 KKKSQKIREDKARQEKQSARNNVGMMRQRQRQEIYALNKVMTELENSHFQKFCEAMN 515
gi 156373873 386 KITEEKQKEKAMKEEQKKIAVSMVQLRQRQREEIYALNKVMTQLENENFRKFMKEKE 442
gi 148698517   6 RKEKSKVKEPAFRVEKAKQKSAQQELKQRQRAELCCDPKTCRPRVSLPASDLCSQQS 62
gi 327289778  21 PPLPKAKEGSASRLEKAKQRAAQQELKQRQRAEIYALNRVMTELEQQQFDAFCKQMQ 77
gi 229365740   6 RKDKPKLNSTPTRGDRARQKSAQQEHKQRQRAEIYALNKVMTELEQQQFEAFCKQMQ 62
gi 731194591   6 rKEKSKVKEPVSRVEKAKQKSAQQELKQRQRAEIYALNRVMTELEQQQFDEFCKQMQ 62
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap