Conserved Protein Domain Family
GGN

?
pfam15685: GGN 
Gametogenetin
GGN is a family of proteins largely found in mammals. It reacts with POG in the maturation of sperm and is expressed virtually only in the testis. It is found to be associated with the intracellular membrane, binds with GGNBP1 and may be involved in vesicular trafficking.
Statistics
?
PSSM-Id: 317988
View PSSM: pfam15685
Aligned: 5 rows
Threshold Bit Score: 455.275
Threshold Setting Gi: 1040222211
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 532111760    2 GNVQSEPSAGGGSRKEQASDRASDSRRTSLVEPEVTPSSPAMRLARGLGVWFPGSSAPPGLLVPPEPQASPSPLPLTLEL 81
gi 514456140    2 GNVQSEPSAGGGSQKEQASNRTSDSRRTSLVQPEVTPSSPATRLARGLGVWFPGSSAPPVLLVPPEPQASPSPLPLTLEL 81
gi 351695258    2 GNVQSERSVGAGSQKE-ALNHTSDSRRTSLVQPEVTSSSPATRPAQGLGVWFPGSSAPPGLLVTPEPQASPSPLPLTLEL 80
gi 675760946    2 GNMQSEPSAGGGSRKEQASDRTPDSRRTSLVEPEVT--SQAMRLTRGLGVWFPGSSTTRRLLVPRESQASPSTLPLTLER 79
gi 1040222211   2 GNVQSEPSAGGGSRKEQASERSSDSRRTSLVEPEVTPASPAMRLARGLGVWFPGSSAPPGLLVPPEPQASPSPLPLTLEL 81
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 532111760   82 PLPVTPPPEEAAAAAVSTPPPPPVGTLLPAPSKWRKPTGTAVPRIRGLLEASHRGQGDPPSLR------P-LPPLPRQLT 154
gi 514456140   82 PSPVTPPPEEAAVAAVSTTPPPPVGSLLPVPSKWRKPTGTAVPRIRGLLEASHRGQGDPPSLR------P-LPLLPRQLT 154
gi 351695258   81 PSPVTPPPEEA--AAVSTAPPPAVGSLLPTPSKWRKPTSTRVARIRGLLEASHSGQGDPLSVR------PlLPLLPRQLI 152
gi 675760946   80 PSPVMPPPEEA--AAVSAPSLAPAGTLLPGPSKWQRPAGTPAPRSRRLLEASHRGQGDPPSLRslppksPpPPPPPRQLS 157
gi 1040222211  82 PTPATSPPEEVAAAGVSTPPPPPVGNLLPAPSKWRKPTGTPVPRIRGLLEASHRGQGDPLSLR------P-LPPLPRQLT 154
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 532111760  155 EKDPVPRAPApPPPTPLEPRK-PPPLPPSDRQPPNRRITPALA---------TSATSPTESQARHIGEGQTAGGACGGAP 224
gi 514456140  155 EKDPAPGAPV-PAPTPPGPRK-PPPPPPSDWQPSSGSITPALV---------TCATGPTDSQAKLSAESQTAGGVREGAP 223
gi 351695258  153 EKDPAPGAPV-PPPTPLEPRK-PPPPPPSDRQPRSRGITPALA---------TSATSPTDSQAKLSAEGKTARGVRKGSP 221
gi 675760946  158 MKDTVPRAPSqSPPS-LEPWK-PPPPLLSEWQPADRRITPALS---------TPTSTPTESQAGPGSQGQTAGRARGGTP 226
gi 1040222211 155 EKDPVPRAPS-PIPPPLKPRKpPPPPPPSNRQPQDRRITPALAtpatpatptTPATPPMESQARHCSDGPAASGARGGAP 233
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 532111760  225 PQAGEGEMARSAASESGLSLLCKVTFKSAPPLCPAAAS----GPLATKASLGGGGGGGLFAASGAISYAEVLKQGPLPPG 300
gi 514456140  224 PQAGEGEMARSAASESGLSLLCKVTFKSGTTLSPAAAS----APLTAKTSLGGGRSGGLFATSGAISYAQVLKQGPLAPG 299
gi 351695258  222 PQAGEGEMARFSASESGLSLLCKVTFKSRAPLSPAAAS----GPLTAKASLRGGRGRGLLATSSAISCTQVLKQGPLAPG 297
gi 675760946  227 PQAGEGEMVRPAASESSVSLLCKVTFKSGPSLAPPAAS----SSLAAKASLRGGGGGGFFAASGAISYAEVLRQAPLPPG 302
gi 1040222211 234 PRAGDGEKARPVASEPGLSLLCKVTFKSGPPL-----PaaaxGSLAAKAPLSGGGSGGLFAASGAISYAEVLKQRPLAPG 308
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 532111760  301 AARTLGEVPRAAQETEGGNGDGEGCSGPPAAPASHARALPPPPYTTFPGSKPKFDWVSPPDGPERHFRFNGAGGGVGAPR 380
gi 514456140  300 APRPTGEVPRGTQDTEGGEGDGEGCSGPHSAPESHTRALPPPTYTTFPGSKPKFDWVSTPEGPERHFRFNGTGGGIGAPR 379
gi 351695258  298 APRPPGEVPRGALETEGGEGEGEGCSGGPLAPESHTRALPPPAYTTFPGSKPKFDWVSPPEGPERHFRFNGAGGGIGAPR 377
gi 675760946  303 AARPLGEVPRGAQEAEGGDGDGEGCSGPPSAPASQARAPPPPPYTTFPGSKPKFDWVSAPDGPESHFRFNGAGGGVGAPR 382
gi 1040222211 309 ASRPLGDVPRGAQEAEGGNGDGEACSSPRSGSASHARTLPPPPYTTFPGSQPKFDWMSPPDSPERHFRFNGAAG------ 382
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 532111760  381 RR---AAA---------LSGPWGS-PPPPPGQAHPTPGPRRPAPALLAPPMFIFPAPTNGEPVRPGPPGPQQLlprpppp 447
gi 514456140  380 RR---AAA---------LSGPWGS-PPPPRGQKHPAPGPRRPAPALLAPPMFIFPAPPNGEAVRPAPPGQLQS------- 439
gi 351695258  378 RR---PAA---------LSGPWGS-PPPPRGKKHPIPGPRRPAPALLAPPM---------------PPATRAL------- 422
gi 675760946  383 RRaasAAA---------LSGPWAS-SPPPPGQMHSAPEPRRPAPALLAPPMFIFPAPTKVKPVRPGPPGLQEL------- 445
gi 1040222211 383 ------AVgaarrraaaLSGPWGSpPPPPPGQTYPAPGPRRPAPALLAPPMFIFPAPTNGEPVRLGPPSQQEL------- 449
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 532111760  448 tpPATPPPV-------------PPPTPQSPVLQPTPLPVARPPT--PCSGHVESALAPAP-------------VPVMPPa 499
gi 514456140  440 --PSPPPPP-------------PPPPPPPPPPPPPPPPPPPPPP--PGTSHTTTAVAAPL-------------SPAPPP- 488
gi 351695258  423 --------V-------------SPPIPRLPAPQQMPMAAVRPPTprPGPGPGESVVVPDP-------------TAPLPPt 468
gi 675760946  446 --PPMPPPTpppalpptppaasPPPTPQPPALQPTPLPVAPSPT--PGPGHAESALAPTPgrghaesalaptlAPALPPa 521
gi 1040222211 450 -----------------------------LL---------------------PAPPPPPP-------------Pppptpp 466
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 532111760  500 lAAEQAQAP----AQAPSPAPAPITADP-SP---PAPPPIKARTRRNKGPRAARGVTREDGAPGDGPRERTAATVTDSSg 571
gi 514456140  489 -SPSQSPAP----SPTPSPAPATTTTEPlTPgpvPVPAPTKTRTRRNKGSRTSRGATREDRTAGVGSRQKSTATTTESK- 562
gi 351695258  469 lAADQDPAPalaaAPSPSPSPAPATTEP-LP---PAPAPTKTRTRKNKGSRSARGATREDRLPGVGPRQK---TVTDSR- 540
gi 675760946  522 lAADQTPAL----DPAPSLAPAPTMAEPsLPt--PADAP-KSRTRRNKGSRAARGTTREDGLPGDGPRERATATVPDSGg 594
gi 1040222211 467 atpspaplappqpparqptplllvlppspgpghvesapapapapalppvsatdqipalglslslslgsgpgppsrsrsrs 546
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 532111760  572 ggGGGSGALTAGAASSGAARHWPPFQVLNSCPCKCYCRHQPRHRRLPRNVSAWLSTPTNHLSEPPWVATIKLAGSLVAGL 651
gi 514456140  563 --GTGSRAALAGVANSSAVRHWPPFQVLNSCPCKCYCRHQPHHRRLPSNVSAWLSTTTNHLSEPPWVTTIKLAGSLVAGL 640
gi 351695258  541 --VGGSGAAPARAANTSAVRHWPPFQVLNSCSCKCYCRHQPHHRRLPSNVSAWLDTTTNHLSEPPWVTTIKLAGSLVAGL 618
gi 675760946  595 ggGGGSGASQAGSANTGAARHWPPFQVLNSCPCKCYCRHQPRHRRLPRNVSAWLSTPTNHLSKPPWVATIKLAGSLVAEL 674
gi 1040222211 547 rlppprlstptnhlseppwvatiklagslvaglehydlqathsn------------------------------------ 590
                         730
                  ....*....|.
gi 532111760  652 EHYDLQATHPN 662
gi 514456140  641 EHYDLQATHSD 651
gi 351695258  619 EHYDLQATHSD 629
gi 675760946  675 QHYDLQTTHSN 685
gi 1040222211     -----------
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap