Conserved Protein Domain Family
NRIP1_repr_1

?
pfam15687: NRIP1_repr_1 
Nuclear receptor-interacting protein 1 repression 1
This domain is the first (N-terminal) repression domain of nuclear receptor-interacting protein 1.
Statistics
?
PSSM-Id: 317990
View PSSM: pfam15687
Aligned: 10 rows
Threshold Bit Score: 391.12
Threshold Setting Gi: 528502050
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 9988061     27 HQAAGGSGTAVDKKS--AGHNEEDQNFNISGSAFPTCQSNGPVLNTHt-YQGSGMLHLKKARLLQSSEDWNAAKRKRLSD 103
gi 60811768    27 HQAAGGSGTAVDKKS--AGHNEEDQNFNISGSAFPTCQSNGPVLNTHt-YQGSGMLHLKKARLLQSSEDWNAAKRKRLSD 103
gi 147899732   27 HQAAGGSGTAVDKLS--VSRAKSDENFKNSGNIFSNCESNAPIRNNSspCQGSGMLHLKKARLLQSSEDWNAAKRRRLSD 104
gi 573879396   27 HQVSGRQSAAATRRSdaGHSERNQNNKTVGSHQLPNHSSNQEDRSV---PLGRATQHLKKARLLRSSEAWNGPETQQLPA 103
gi 557021628   26 HQATGGSIAAADKRSgtGGHGGRDQKYRTSSSNLSSCQVNGSGRNAS---LGSGTLHLKKARLLQSSEDWNEAKRRRVSD 102
gi 528492827   27 HPVNTGPAATATQRSepVHNNEENANSVTRAFQLHNHGALSPEKGS---PPSATSQHLKKARLLRSG-AWSE-DSQKQSS 101
gi 528502050   27 HQVAGGQGAAATQSG-----SQEQRNKDGTGHAQPNHGIRQEQNRTY--SHCGASQHFRKARLLNS-EAWTESETQRRSV 98
gi 637326994   27 HQAAGGSGSMVDKNP--IGPVAEDQNCKVSGNTSPSCQRDGPVPNTn-iYRSSGMLHHKKARLLQSSEDWNAAKRRRLSD 103
gi 542232552   27 hpVVAGPGATASGRSeaAHSNQEQGDKVGGPFQLPNHGPTAPKGGTn-gPTLGSSQHLKKARLLRSG-AWNDPGNQRMSS 104
gi 597761648   27 HPVASGPGPTATRRSeaGNNDGEPGNQGTRGIQLPNHGSSPPEKGS---PPGASSQHLKKARLLRSG-AWSEVEKERKKD 102
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 9988061    104 SIM-NLNVKKEALLAGMVDSVPKGKQDSTLLASLLQSFSSRLQTVALSQQIRQSLKEQGYALSHDSLKV---EKDLRCYG 179
gi 60811768   104 SIM-NLNVKKEALLAGMVDSVPKGKQDSTLLASLLQSFSSRLQTVALSQQIRQSLKEQGYALSHDSLKV---EKDLRCYG 179
gi 147899732  105 SVP-GVNGKNETFLAGMVANAPKGKQDSTLLASLLQSFSSRLQSVALSQQLKQSLEEQGFSLGQETVHe---EKNNQCLG 180
gi 573879396  104 SVV-NLNGQNRDLLTGALDSSPKCKAESTLLASLLQSFSSRLQSVALSQQIMQNLKQQD-NLQSDKSTQv-eDEALRCYG 180
gi 557021628  103 PIM-DLNVKKDALLTGMVDSVPKGKQDSTLLASLLQSFSSRLQSVALSQQIRKSFKEQGYTLSSDCTRe---EADVGCYG 178
gi 528492827  102 TGV-EVNGQRREHYKGGLDGSGQG--ESTLLASLLQSFSSRLQSVALSQHISQSHKQLD--RESSESAPvdpKETYQSYG 176
gi 528502050   99 PSV-ALNGQHEDHHSGQ-NGSSQDKGESTLLASLLQSFSSRLQNVSLPQQIIQGLRPPDTSCQISKPAQe-eKADVPCHR 175
gi 637326994  104 SIV-DLNGKKEALLAGMVENVPKGKQDSTLLASLLQSFSSRLQSVALSQQIRQSLKEQGYSLSHDSLQV---EKDLRCYG 179
gi 542232552  105 PPA-ELNGQAGGMQNGALEGSPHA-GESTLLASLLQSFSSRLQSVAMSQH---SNKPPSECSSPSKAPPa-dKEPLPVYG 178
gi 597761648  103 APMgQVNGQVKEHHKAALDSSSQ--GESTLLASLLQSFSSRLQTVAMSQCITQSNKQLD--GESNESAPa-dKDTFQGFC 177
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 9988061    180 VASSHLKTLLKKSKVKDQkPDTNLP-DV-TKNLIRDRFAESPHHVGQSGTKVMSEPLSCAARLQAVASMVEKRASPATSP 257
gi 60811768   180 VASSHLKTLLKKSKVKDQkPDTNLP-DV-TKNLIRDRFAESPHHVGQSGTKVMSEPLSCAARLQAVASMVEKRASPATSP 257
gi 147899732  181 LASNHLKTLLNKSRSKEK-----VT-DS-KMTAKASIQEKSSHSGQSSTKAGAAEPISCAARLQAVASMVEKRSSPTVSP 253
gi 573879396  181 SASSRLKGLLKKNKMQNH-NSVPYQ-RR-NSQERFSDSPEASQSS---VQPAARDSISCAARLKAVASIVKNRSSPTSSP 254
gi 557021628  179 TASSHLKALLKKSKQKELaSLSNVT-GNnHQTLAKERLPKSSREMQGGAKP-AGEPASCAARLKAVASLVEKRSSPAPSP 256
gi 528492827  177 TASGRLKSLMRKSKHQNH-NTVPYC-RQ-SNQNRGSDSPRSSQNS---AQPTSSESMSCTERLKAVASMVRTRSSPAPSP 250
gi 528502050  176 PASSHLQELVSKSKLQNHsNSVPYQqRR-SSHESFSQSPKALQSSTPSPSPESL---SCTERLKAVASLVNIRSSPAPSP 251
gi 637326994  180 VASSHLKTLLKKSKAKDEkLETGLP-EV-TANVVKDRFIESSHTAQSSGPKvMNESLSCAARLQAVASMVEKRSSPATSP 257
gi 542232552  179 TASSRLKGLMRKSKLQNH-SNTPYS-RRgHSQDRPPESPRSAHSATPPAAPtAADSVSCAERLKAVANMVKIRSSPAPSP 256
gi 597761648  178 TASSRLKGLMRKNKQQNH-NTVPYS-RR-NSQDRRSESPRNSQSS-------ATDSMSCAERLKAVATLVKNRSSPASSP 247
                         250       260       270       280       290       300       310
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 9988061    258 KPSVACSQLALLLSSEAHLQQYSREHALKTQNANQAASERLAAMA--R-LQENGQKDVGSYQLPKGMSSHLNGQAR 330
gi 60811768   258 KPSVACSQLALLLSSEAHLQQYSREHALKTQNANQAASERLAAMA--R-LQENGQKDVGSYQLPKGMSSHLNGQAR 330
gi 147899732  254 KPSVACSQLALLLSSEAHLQQYSREHAVKAQSASQLASERLAAMA--R-LKETSEKDHGHFPMSTNLPTPLNSPAR 326
gi 573879396  255 KPSVACSQLALLLSSEAHLQQYSREQALKAQLSGRSASERLAAMAtqQ-TQDIKQSSMGQHQVSADIVNPLNGQNG 329
gi 557021628  257 KPSAACSQLALLLSSEAHLQQYSREHSLKAQSANRSASERLAAMAsqK-LQENLQSDLGQCNLLKEMPGHFNGQGQ 331
gi 528492827  251 KPSVACSQLALLLSSEAHLQQYSREQALKAQLTSRSASERLAAMAtqQ-TQDNRPPSMGQPTTTPDMLSSLNAQNG 325
gi 528502050  252 KPSVACSQLALLLSSEAHLQQYSREHALKAKLSGRSASERLSAMAtqQ-TPDKQPTTSSQ----THGLSLLQTKNG 322
gi 637326994  258 KPSVACSQLALLLSSEAHLQQYSREHALKAQNASQVASERLAAMA--R-LKESVPKDVGHFKLSKGMESHLNGQVR 330
gi 542232552  257 KPSVACSQLALLLSSEAHLQQYSREHALKAQLSGRSASERLAAMAnqQhNQDKRPPSLPG---APDTLSSLTTQNG 329
gi 597761648  248 KPSVACSQLALLLSSEAHLQQYSREQALKAQLSGRTASERLAAIAtqQ-TMDKRPR---ESLIAPDMLSslnalng 319
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap