Conserved Protein Domain Family
NRIP1_repr_2

?
pfam15688: NRIP1_repr_2 
Nuclear receptor-interacting protein 1 repression 2
This domain is the second repression domain of nuclear receptor-interacting protein 1.
Statistics
?
PSSM-Id: 317991
View PSSM: pfam15688
Aligned: 13 rows
Threshold Bit Score: 282.798
Threshold Setting Gi: 765140046
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 9988061    411 PTTID-EYSDNNPSFT-DD-SSGDESS-YSNCVPIDLSCKHRTEKSE---S---D---QPVSLDNFTQSLLNTWDPKVPD 477
gi 123995373  411 PTTID-EYSDNNPSFT-DD-SSGDESS-YSNCVPIDLSCKHRTEKSE---S---D---QPVSLDNFTQSLLNTWDPKVPD 477
gi 573879396  414 PLRSEsEYSNLENSLT-KD-NSDAESS-HSSCSPIDLSVKGRASGSG---L---G---SSSSLDKLTETLISNWNPETSS 481
gi 637326994  410 PTTVD-EYSDNNPSFT-ED-DSSDDESsHSTCLPIDLSFKQKNSASD---S---G---PPSSLDNLTQSLIHNWDSKVPG 477
gi 528502050  407 PLFSDsEHSNPDSSLT-KD-SSDAESS-YSSCSPIDLSLKGRTNVQT---PvstS---SSPVLDRLPESSFNMWKPESSP 477
gi 147899732  407 PTTTD-DFSDNNPSFT-EDeTSDDESS-HSNCAPIDLSFKNRVDKPE---V---L---NTASIDNLTESLLKNWDPKVEG 474
gi 597733992  413 PLFSDsEHSNSGSSVQ-KD-SSDAEST-YSSCSPIDLSLKNKVNMPT---P---LsssSSPALDKVTESLRNRWKSGSPT 483
gi 557021628  413 PPVTD-EYSDHNLSLT-EE-SSDDDSC-YSSCTPIDLSLKQRGNKP----A---F---ESASLEKLTESLLQNWNPKAAT 478
gi 326913165  409 PTTID-EYSDNNPSFT-DD-SSDDDSS-HSNCLPIDLSFKQRTDKPD---A---G---PPASLDNLTQSLLHSWDPKVSC 475
gi 765140046  474 glkgtpatftstfssstvvisstpavftphssvssftssttsassvliaasssssssvstsslDKLTETLLNKWKPEPSG 553
gi 941797166  475 tppssssssmfssttvfssppvtispqaptqppttsfspssmavssvsypissssssfstSSLDKLTESLLNKWKPEPSR 554
gi 597761648  406 sHQSDsEYSNQENSLT-KD-SSDAESC-YSSCSPIDLSMRSRVSSQKsepP---S---SASSLDKLTETLLNKWKPETPG 476
gi 395528964  409 PTTID-EYSDNNPSFTeDD-SSGDESS-NSNCVPIDLSFKHRVEKPE---S---S---QPASLDNLTQSLLNTWDPKVPG 476
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 9988061    478 VDIK-ED--QDT-SKNSKLNSHQKVTLLQLLLGHKNEENVEKNTSPQGVH--NDVSKFNTQNYARTSVIESPSTNRTTPV 551
gi 123995373  478 VDIK-ED--QDT-SKNSKLNSHQKVTLLQLLLGHKNEENVEKNTSPQGVH--NDVSKFNTQNYARTSVIESPSTNRTTPV 551
gi 573879396  482 HKVT-EA--RES-ENSSVIKPHHKVTLLQLLLGHKNNEKVNKNSDNPDLQscTTSKPNCLPTGRVTPSSRFEETRTRNSP 557
gi 637326994  478 LENT-EE--KDP-PKTAKLNPHQKVTLLQLLLGHKNEDTIEKLPETEGMLvtTDVAKFNLPAGNRTPVTDCINTSRNTPV 553
gi 528502050  478 LKVSaDH--REM-DSCSEMKPHHKVTLLQLLLDHKNNERVNKSLDNPDLLraVIP---KVTSASTSSQSVFSTSRCKDPS 551
gi 147899732  475 LVIN-KDnnRDP-SLDSTLKPHQKVTLLQLLLGHKADENPEKMEDLQGSQkrSDLTKFNLPIQRHG--SENTHVHNSASL 550
gi 597733992  484 GIVPtEP--KEIhNICPEMKPHHKVTLLELLLDHKNNEKASKALVNPDLQpvIIQSK--VSNPSTSSPSPFYAGRCKDTR 559
gi 557021628  479 HKMQaIK--KGV-STESNLKSHQKVTLLQLLLGHKKDGKEGNMQDTQGLQpgCNLITARSHTSTGSSLTGNNSSKPTTPL 555
gi 326913165  476 PENK-ED--KDT-PKASKLNPHQKVTLLQLLLGHKSEEKVDKSNDPQGPHsaADVAKFTVQTGKRTPVTDSPNANRMTPL 551
gi 765140046  554 SHVS-KN--KEP-KMSPDLKSQPKVTLMQLLLERRNNEILNKSMSKQDLPldITM--GTLYQSQQK--LPWEETRATSPS 625
gi 941797166  555 STVS-KN--KEP-EMNPDLKSHPKVTLMQLLLERRNNEMANKSTGRQDSPldITM--ANMSRNQQKGSVTWEEGPTKSPI 628
gi 597761648  477 PKVP-EA--REL-EMSPDMKSHHKVTLMQLLLDRKNNEKVNKIADNPDLQhdATL--SNMARGPLKRLGTLEESRTQNAL 550
gi 395528964  477 LNVK-ED--RDT-SKNSKLNPHQKVTLLQLLLGHKNEENLEKTTGSQGSH--SNVTKFSAQSSKRTPVLESPNVNQATPV 550
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 9988061    552 S-------------TPPLLTSSKAGSPINLS---QHSlv-ikWNSPPYVCSTQsekltn-tasnhsMDLTKSKDpp-gE- 611
gi 123995373  552 S-------------TPPLLTSSKAGSPINLS---QHSlv-ikWNSPPYVCSTQsekltn-tasnhsMDLTKSKD----Pp 609
gi 573879396  558 Dalcf-----rklqSLPVFS-QEQDTNGSAS---PYS-----LSLSPQVQAIP-------------LDLCKAKS----H- 605
gi 637326994  554 N-------------TPPLLASTKADSPINLS---HHSpllikHNSSPYTCIIQpervin-paskhlMDLTIQKElq-gS- 614
gi 528502050  552 DlsghcglsckspkLLPTLS-QSRDSNCSAS---PYT-----LYGSPHSQCVP-------------LDLCKVKQ----P- 604
gi 147899732  551 N-------------TLPINNSLKSDSPVNLSqpfPPK-----NTFTSYISNIQserhvn-aaskhlIELTRNKSfh-nP- 609
gi 597733992  560 ElspncrlntrspkLLPTFSQGSRDCNTRAS---PYN-----LCSPSHTQSAP-------------LDLCKTKT----P- 613
gi 557021628  556 S-------------TPELFRAVKTTSPLNLS---HPPqt-trHSSPLHVSNLQssdqpqkpspkqlTDHNKKKEaqaaP- 617
gi 326913165  552 N-------------TPPLLASAKADSPINLS---HQSla-ikRSSPPYACSIQpdrlvn-paskhlIDLSKSKEiq-gA- 611
gi 765140046  626 Erpv--------apAQSMYS-LSRDPNGALS---PYS--------STHVQSGP-------------LDLCKSKT----F- 667
gi 941797166  629 Erpa--------gpSQSVYS-LSRDTGPAMS---PYS-----YP-SPHVQSSP-------------LDLCKSKT----F- 672
gi 597761648  551 Erlt--------ggGLSTFS-LSEDTSNTPS---PYS-----YS-SPIVQNSP-------------MDLCKSKN----H- 594
gi 395528964  551 S-------------TPPLLTSAKADSPINLS---QQSlv--kHSSPQYVGNVQpkrlmn-paskhlIDLTKNKElqgtN- 610
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 9988061    612 --KPAQNEGAQNSATFSASKLLQNLAQCGMQSS-MS----VEEQ-R-PSK-QLLTGNTDK-PIGMIDRLNSPLLSNKTNA 680
gi 123995373  610 geKPAQNEGAQNSATFSASKLLQNLAQCGMQSS-MS----VEEQ-R-PSK-QLLTGNTDK-PIGMIDRLNSPLLSNKTNA 680
gi 573879396  606 --SNEN----VEESSFSASKLLQNLAQCGLQKS-IPsppvETSVsP-GIR-QTYEPRTDK-PVALLERLNAPLTKNKTTV 675
gi 637326994  615 --KQNRKETPQASSSFSASKLLQNLAQCGMQSS-VS----VDEQ-RqSSK-QVMTLNTEK-PIGLIDGLNSSMLTNTSST 684
gi 528502050  605 --TSDVR---VKEPAFSASKLLQNLAQCGKQTP-DIspptKAHL-P-PVKlMTQELKVNH-PPTLIEKLTAPVQKN--TP 673
gi 147899732  610 --TPVVNESAQCNAAFSASKLLQNLAQCGLQTA-AP-----DEQ-K--VQ-KTVSAPNGK-TLGLIDRLSSPLITNQSHA 676
gi 597733992  614 --STVARVSSVKEP-FIASKLLQNLAQCGKQTPtTSspppKASLpP-IKR-QTQELKSSSgSASLLERLTAPVQK-SNTP 687
gi 557021628  618 --SLESKNNAQTSIPFSASRLLQNLAQCGMQSP-TS----VAEK-N---R-QQFDVKTQQ-SLGLFDRISSPIISDSSTM 684
gi 326913165  612 --KLSRNDSPQNSSAFSASKLLQNLAQCGMQTS-MS----SEEQ-R-SGK-HLLVGNTDK-PVGLIDRLNSPLLTNKLST 680
gi 765140046  668 --TTER------EPAFSASKLLQNLAQSG--TT-SSpppiSSGK-Kl-----TQELDVNR-PLALLERLNAPVNRATPTQ 729
gi 941797166  673 --PADK----ASEPAFSASKLLQNLAQCG--TT-SPpppiSSGK-Ga-----SQELNDSR-PHALLERLNTPVNRTTPTP 736
gi 597761648  595 --TNEK-----TEPAFSASKLLQNLAQCGLQNP-SPspplQTHR-PaNIR-QSPELEVDR-PQSLLDGLVPPVKR-NKTP 662
gi 395528964  611 --KPNQNDSAQNSTTFSASKLLQNLAQCGMQSS-VS----IEDQ-K-TSK-HLLNVNIDK-PVGLIDRLSSPLLSNKPNI 679
                         330       340       350       360       370       380
                  ....*....|....*....|....*....|....*....|....*....|....*....|
gi 9988061    681 VEE-NKAFSSQPTGPEPGLSGSEIENLLERRTVLQLLLGN-PNKGKSEKKEKTPLRDEST 738
gi 123995373  681 VEE-NKAFSSQPTGPEPGLSGSEIENLLERRTVLQLLLGN-PNKGKSEKKEKTPLRDEST 738
gi 573879396  676 LEEpLVNSMKLPYVMDPSPSVSEIENLLERRTVLQLLLGAtTSKEKASGKRKRPVdkgds 735
gi 637326994  685 FEE-NTIVSNQPLPAEQKIPSSEIQNLLERRTVLQLLLGT-SNKGMSETKETMLSKEEGL 742
gi 528502050  674 LWEeATA--KPSNVPEATQQVSEIENLLERRTVLQLLLGNaPQKEKVGNKRKREHSKTNS 731
gi 147899732  677 FEE-DTSFSSPPTPSDSRFPGSEIENLLERRTVLQLLLGT-PNKGKLEKSPNITIKDENQ 734
gi 597733992  688 TWEg--SHMKVPAVAEPTQHGSEIENLLERRTVLQLLLGNkTQRERVGHKRKRESAKvis 745
gi 557021628  685 SEEnRPAAGRQLSQSDPEVASSAIENLLEKRTVLQLLLAT-SKKGKKAKKQRADLKDESP 743
gi 326913165  681 HEEnNKILSCQPVPTEQGLPGSEIENLLERRTVLQLLLGT-PNKGKNEKKERVLLRDESS 739
gi 765140046  730 HSDeASGSGTPFSHKEASPP-SQIENLLERRTVLQLLLGTgSASSSTGRKDRPGASGRRS 788
gi 941797166  737 LSDgASGSSTPFSRKEPSPPSSQIENLLERRTVLQLLLGTgSTGATAGRKERPSGSGQGs 796
gi 597761648  663 LFEpPPTTFTLFGQERSPPASTQIENLLERRNVLQLLLGNaSHKEKSSGRRSTEaatgaf 722
gi 395528964  680 LEEnNKTFNNQSTVSEPGLSGSEIENLLERRTVLQLLLGN-PNKGKSEKKERISLRDESS 738
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap