Conserved Protein Domain Family
PPP1R32

?
pfam15691: PPP1R32 
Protein phosphatase 1 regulatory subunit 32
PPP1R32 is a family of eukaryotic proteins thought to be involved in the interactome of protein phosphatase-1.
Statistics
?
PSSM-Id: 317994
View PSSM: pfam15691
Aligned: 13 rows
Threshold Bit Score: 533.9
Threshold Setting Gi: 196000907
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81884245     2 MGKLPLGVVSPYVKMSSGGCSDPLKFYATSYCTAYGR--EEFKPRMGSHVGTGYKSNYRPLVSYQPHLDTL---DNPAVG 76
gi 260789659    1 MGRLPMGSRTSHVQGSTGPQYSVMNFYCTQNSTTYGQ--EGFKPRTGKHVGTGYQSNFRPGVYYSRHLDDL---DNPEMG 75
gi 198431865    1 MVKLRTGPVTNHIKVSHGADTHVNKFYHTRYGTEFGW--QNYKPRTGRHVGTGYSSNFRPQIYYTRSLDNF---DNPVMG 75
gi 405964735    6 MGPLPQGSRNVHIMASQGPDINMMKFYNTTNSTTYGRyyDKFKPRPGRHTGTGYLSNFRPAVYYSQRLDEV---DNPVLS 82
gi 196000907    1 MGRLPVGKATGHVLASQSADIDLNRFYVTAYSTNYNK--KEFEPKPGRHIGTGYASNLRSAIGYSKKLDDV---DNPAMG 75
gi 655882147    2 MGKLPLGVVSPYVKMSSGGCTDPLKFYATSYCTAYGR--EEFKPRTGSHMGTGYKSNFRPMASYQANLDAL---SSPATG 76
gi 348560243    2 MGKLPLGVISPNVKMSSGGCTDPLNFYATSYSTAYGR--EEFKPHRGCHMGTGYKSNLRPWVSYQPSLDTL---DNPAMG 76
gi 395852538    2 MGKLPLGVVSPYVKMSSGGCTDPLKFYATSYCTAYGR--EEFKPRMGSHMGTGYKSNYRPVVSYQASLDAL---DNPAMG 76
gi 426368735    2 MGKLPLGVVSPYVKMSSGGYTDPLKFYATSYCTAYGR--EDFKPRVGSHVGTGYKSNFQPVVSCQASLEAL---DNPARG 76
gi 1033368226  29 MGRLPLGVVSPYVKTSSGGSIDPMKFYCTSYGTAYGR--EGFRPRIGFHSGAGYKANYRPVVQYKTSLDKL---DNPAVG 103
gi 1023016466   2 MGKLPLGVVSPYVKMSSGGCADPLKFYATSYCTAYSR--EGFKPQIGQHKGTGYQANYRPLVSYHPTLDSF---DNPVVG 76
gi 395544376    2 MGKLPLGVVSPYVKMSSGGCADPLKFYATSYCTAYSR--EGFKPQIAQHKGTGYQSNYRPIVSYQPSLDTLdspDNPTAG 79
gi 156391923    1 MGRLPYGPGNAHMLQSKGADINVMKFYCTEYATRYGE--DGFNPRTGKHLGTGYQSNFRPGVYYNRRLDEL---DNPAMG 75
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81884245    77 --EQIHDTSKSVA-SQSYAPLEVPDGKQPLPWNLHQTT-SGYGREKVNIGPLSKEVRKVHFDTQDHGPqtiTGLEPKEVP 152
gi 260789659   76 --RIVARNYNTVT-KLHFLPSKGSDGRDPLPRNIHMKG-SGFVRQTPITTPTVAEVRKVHVDTHHTAP---FSILPKAKP 148
gi 198431865   76 --FLLTDNYETVT-KRHFREAKDSDGKDELPSVVVNKQeSGFIRERPLTVPTTTEVRKTFYDKRLYGGnsrPGLVPRHRA 152
gi 405964735   83 --KICAKNYHSVT-ELHYQPYKENSGTEPLPGNVHQKG-SGFVRQKPITNPTIREVNGVFIDTRAATAp--sDILPKSKP 156
gi 196000907   76 --QILVDAYASGTlLRDYKGSVLADGKEALP-SIHMQTlSGFAKDIPKTLTVSKEVKQSFFDTDGSS-----SLLPKHRA 147
gi 655882147   77 trEQARDNFQTVT-GQSYRPLEVPDGRGPLPWSVHQTN-SGYGQERPNTGPLTTEVRKVHFDTQDHGaqaivGLEPKERP 154
gi 348560243   77 --EQIQDTFQTVT-SKSYGPWEGPDGRTPLPWSMHQGC-SSYSRERPGMEPLTKEVKKVHFDTQEHGpkaipGLEPKAVP 152
gi 395852538   77 --EHVRDNYKTVT-SQSYRPLEVPDGRYPLPKNLHQTS-SGYGREKPSAGPPTKEVRKVHFDTQEYGpqaitGLEPKDMP 152
gi 426368735   77 --EQARDHFQSVA-SQSYRPLEVPDSKHPLPWSMRQTS-SGYGREKPSAGPPTKEVRKVHFDTQEHGpqaitGLEPREVP 152
gi 1033368226 104 --TLLQDNYESTT-TKHFQPFQLPDGKYPLPWNVHQSG-SGYVREKPLTFPTTKAVKQVHFDTADQGsgaipGLDPRHTP 179
gi 1023016466  77 --EPAKDAPQSVY-GQSYHPMELQDGRNPLPWTVYQSG-SSYVRDKVNSCVPSKEVKKVHFNTQDYGghaitGLEPKTVP 152
gi 395544376   80 --EQMKDKDQMVF-AQSYRPVELPDSRYPLPRSLYQPG-YGCAHDKAHSCPSSKEAKRVHFNTQDHGpqaaiGLEPKTVP 155
gi 156391923   76 --SLVADNYASIT-KKHFLPSKGSPGNDPFSRGMFMTAtSGFVKDIPGTLPRSKQVAAVHVDTSRAG-----TVYPFHRP 147
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81884245   153 LIHQQQGKGSTEWENSRYGPRFMTSEYNSKYLKEsPNHP--DLLLKKTIGSKEETGFTEESTKNPIVFQPPS---QAYPG 227
gi 260789659  149 LLHKIQSKDPVELENGSFGPGFMTTETHVRFDGK-PMEK--TDFYHNSIGNKEESGFTHAYNVEPVTFHPGSphkGEMPG 225
gi 198431865  153 LLHKIQPKDPVEQENNDHGPAYMRSETFSKFLGE-PTAP--LDVHYKDVGPNEDSGFTHNKNIEPITFREDDdhkNIVSG 229
gi 405964735  157 RLHTLRAKDPVELENGGYGPKYMLSETKHQFVGEqPDRKihVDLTNKTVGPHEESGFTHAYNVEPITYIPGSphkNERPG 236
gi 196000907  148 LLSTLKKHDPIRDENEGYGPGYMKSETLAKFQGq-SLRR--ANTADSTIGRKELSGFSKAFTTEPITFRA---------- 214
gi 655882147  155 LLFQQQDKGSLAWENGGYGPRFMTSEYNSKYLKepSNLP--DLLQKKSIGAKEETGFTEESNKNPIVFQPPS---QALPG 229
gi 348560243  153 LLLQQQDRGSPERENACYGPRSMTSEYSSKYLRelSTRQ--DLLQKRSIGAKERTGFTEGSDKGPLDIQSPS---QVLPP 227
gi 395852538  153 LLRQQQGKGSLEWENWRYGPRFMTSEYNSKYLNepIHQP--DLLQKKSIGAKEDTGFTEETNKSPIVFQPPS---QALPG 227
gi 426368735  153 LLHQQQGQDPLERENFRHGPRFMTSEYNSKYLRdpLDQP--DFLQKKSIGAKEGSGFTKQSHQSPIVFQPPS---QALPG 227
gi 1033368226 180 DLHKLQGKGSSDVENARHGPRYMSTEYGSKFRFniPGQP--DFLQKKTIGAREETGFTEGGLANPILDKATA---QAS-- 252
gi 1023016466 153 TLHEYVGKGGIEMENYRYGPRFMTSEYNSKYRYeiPGQP--DFLQKKTIGAKEDTGFTEQGTKNPIVPQS-------LPG 223
gi 395544376  156 VLHPPMAKGSPDTENYRYGPRF-SSEYNSKYRHdvSGPP--DFLQKKTIGAKEESGFTEQAIKSPLAFQP-------FPG 225
gi 156391923  148 ILHSLSQKDPISRENARHGPLYMSTEAHTNFKGi-PSQR--MDTSKKTVGYKEGSGFTHAYNDEPITFYPMEayeGLRDP 224
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81884245   228 DPVLHP-GRSITKSDYLPI--SHPQGNEFLPVLARGSDRDTGYS----------------------------R------- 269
gi 260789659  226 WMTDRPtGVSIMKTNFLRS--EDPSGKEPLPNLTDRAVRDTGFT----------------------------H------- 268
gi 198431865  230 SLTDRPtGVSVTDTSFNPW--FDANGREPLPSITQRSSHKTGFV----------------------------Reksrely 279
gi 405964735  237 WATGRPtGISIMKTDFLRS--EYSKGNEPFPVLSHGSERGTGFT----------------------------Hekakply 286
gi 196000907  215 ---------------------YTAKGKETFPSIASRGRRSDGYTegtttknvylensnfhgftdqedlhpkvR------- 266
gi 655882147  230 DSVLLP-GRTVTKADFVPM--SLPHGDENLPVLARGSERETGYS----------------------------R------- 271
gi 348560243  228 SQVL-P-GCSVTKADFLPMtdS--QGSDFLPVLALGSERETGYS----------------------------R------- 268
gi 395852538  228 DPTLLP-GRSVTKSDFLPM--THPRGDEFLPVLARGSERETGFS----------------------------R------- 269
gi 426368735  228 DPALLP-GQSVTKSDFLPK--THLHGDEFLPVLARGSKRETAFS----------------------------Q------- 269
gi 1033368226 253 ----IP-GVSITKTDYLPS--TFPHGDEFLPVLSKGSERGSGFS----------------------------R------- 290
gi 1023016466 224 EPVLSC-NRSVSKSDFGSY--SNPHGDEYLPVLAKGSERESGFS----------------------------R------- 265
gi 395544376  226 DP-----------------------GDEYLPVLAKGSERESGFS----------------------------R------- 247
gi 156391923  225 RFTHRPtGFSIMKGSFRPV--EYQHGNEQLPVLSHGSERNTGFT----------------------------Hgtkarpv 274
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81884245   270 ---------------------V--------------------------SE---RSLNPRMPTPSSQPTSMSHRSYQPPQR 299
gi 260789659  269 ---------------------EtakpqflghpanaftrveqvpslvaeRTrknDPAEYVNMAAPNNHSSLTKNWFKGAQR 327
gi 198431865  280 scknprk-aftgirevpplvaE--------------------------RIrkkDPAEYLNLLHPHNKKSVTFATYLGKQK 332
gi 405964735  287 vnrvmgd-aydkaenipslrlE--------------------------RTkkvDPTEYLNMQNPNNHSSITMKMYQGQQR 339
gi 196000907  267 ---------------------D--------------------------YLkkkDPLEYVNITNPTRNINLNKIQFDGRLV 299
gi 655882147  272 ---------------------A--------------------------TE---RPLNLRVPPLGPEPGSLSHRQFQPPQR 301
gi 348560243  269 ---------------------V--------------------------NEr--RTLDPRVTSPGPVPSSTTHGHFRPPRP 299
gi 395852538  270 ---------------------V--------------------------NE---RTLNTRVTTPNPELNSINHWQFQPPQR 299
gi 426368735  270 ---------------------G--------------------------NE---RILNPRVPPPCPEPSSVSHQQFQPLHR 299
gi 1033368226 291 ---------------------Q--------------------------NNl--GPGTEEIPRSTAVQAPLSHSQYQGLQR 321
gi 1023016466 266 ---------------------Q--------------------------KEklfQATPPIGPASLSESGSLSHRQFQGLQW 298
gi 395544376  248 ---------------------A--------------------------KEkhlPPTPPAGPPSLSEPSSLSYRQYQGMQW 280
gi 156391923  275 fyhhtmdeaytklnethprvqE--------------------------RVqkrDPCEFSNMTNPHNHTSMAKLTFRGKQR 328
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81884245   300 MQQSNVALLGRESVGNKEPTGFTLNNPSYVRSSYEQDRDQRYLTTYNQGYF-ENIPKGLDREGWTRGGIQPQKAGAYALS 378
gi 260789659  328 ETPSETDRLGRKAVGWQELSGYSANNDRYVQQPPTLEDLQRFVTHYQIRFH-DKNPEGIDREGHTWGGLQEQLPDGFTKS 406
gi 198431865  333 MDQSEEELLNRDKMGDQELTGHCRNNDRYLETEDT--DPQRYLTNYNLRHF-DMNPEGKDREGWVMGGVQNAEENGYCRD 409
gi 405964735  340 PTPTEADRLNTTAVGSQELSGYSENNDRFVAQ---PDDYKRFTTHYLTRFGqDPTPVGRDREGHTRGAVQTQKPDGFTKS 416
gi 196000907  300 RDKSNSEKIGLVKYGNKELSGFTTNNISKINNFDRANAAEGFLTTYNAKF--RNVNSGKNFSQRSPANINPAKPDGYTKS 377
gi 655882147  302 LQQSNVAMLGRETIGNKELTGFSLNNPSYVRSAYDPDRDSRYLTTYNQGYF-ENIPKGIDREGWTRGGIQPQTPGGYAIN 380
gi 348560243  300 MQQTNVALLGRQAVGSKEPTGFSLNNTSHFRSLHDPDRDSRYLTTYSQGFF-ENIPKGLDREGWTRGGVQPLKPSGYALN 378
gi 395852538  300 MQQTNIGLLGRETMGKKEPTGFSINNSSYVRSPHDPDRDNRYLTTYNQGYF-ENIPKGLDREGWTRGGIQPQIPGGYAIN 378
gi 426368735  300 MQQTNVALLGRETVGKKEPTGFSLNNPMYVRSPCDPDRDQRYLTTYNQGYF-ENIPKGLDREGWTRGGIQPQMPGGYALS 378
gi 1033368226 322 QPQTKTSLLGREYVGNKELTGFSHNNLSYVTPAYDPNHANRFLTSYNSKFY-ENIPKGVDREGWTRGGIQPQQAGGFATN 400
gi 1023016466 299 VPQTTNGMLVLEVLSSPTGSSFLLSGLsllpcclgsqkpwginspgtqgpqslgswplpslassiqhvephfqapypfap 378
gi 395544376  281 TPQNNNALLGRELLGAKEPSGYTSNNPGYNRGPPDPDY--RFLTTYNQRYL-ENTPKGLDRESWFRGG--SQHLGGYGLN 355
gi 156391923  329 QDLSEAGRLGNTAVGNKELTGYSENNDQFFETAETADTLRRFGTHYRAKFY-DMNPMGEARMGRTRGEVMVQLPDGFTKS 407
                         490       500       510       520
                  ....*....|....*....|....*....|....*....|
gi 81884245   379 EPVT--HMDTTPNPTETLRHLHPHVGRTLTSVDPFYRDVP 416
gi 260789659  407 TAVH--SYGPAINTTDTLRRLHPYVSRSIKGTDPFYDDHT 444
gi 198431865  410 FCVH--SMGRVEDMTRKLQRLQPYVARSIKKRDTFFVDHT 447
gi 405964735  417 TAVH--SHGPDVQSTATLRRLEPYVSRSIKARDVFFDDHT 454
gi 196000907  378 IQVH-----KSSDTTAALRKLNPYVARSIKRRDPYYDDHv 412
gi 655882147  381 HPVT--HMEATPNPMESLQRLHPHVGRTLTSTDPFYRDSP 418
gi 348560243  379 QGPT--CLEPSPTAPESLQHLH-RA-RAPTPTDSFQatpy 414
gi 395852538  379 QPVT--RMEASPNPTESLRRLHPHVGRTLTSVDPFYRDTP 416
gi 426368735  379 QPVS--CMEATPNPMESLRHLHPHVGRTLTSADPFYQNTP 416
gi 1033368226 401 NHAT--DLGTDPNATETLRTVHPHVGRTITTVDPFYRDSP 438
gi 1023016466 379 csrilvcllpwppglllaqglglsrfssclitppssrgmt 418
gi 395544376  356 PPGSqhSLENYHSPAESARRPHPQVARTLTALDPFYRHTP 395
gi 156391923  408 TSVH--EFGPVINTTVQLRELEPYQARSIKARDPFHDDHT 445
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap