Conserved Protein Domain Family
Med26_M

?
pfam15694: Med26_M 
Mediator complex subunit 26 middle domain
Med26_M is the middle domain of subunit 26 of Mediator. Med19 and Med26 act synergistically to mediate the interaction between REST (a Kruppel-type zinc finger transcription factor that binds to a 21-bp RE1 silencing element present in over 900 human genes) and Mediator.
Statistics
?
PSSM-Id: 317997
View PSSM: pfam15694
Aligned: 18 rows
Threshold Bit Score: 332.577
Threshold Setting Gi: 47216408
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158706142  175 SSSPPSNGIRGTP-EPLL---E------KDDEVPSDRIRLEHLDNDRHN-KIPVNAVKPHPSSPGLTKLPSTSSLLKASV 243
15_pfamImport   1 SSPPPTNGIGGSP-ESFPspvD------VNLHAGPESSRTELSENDKHN-KIPVNAVKPHTSSPGLVKPSSTSSLLKTAV 72
16_pfamImport   1 SSPPPTNGIGGSP-ENFPspvD------INLHAGPESSRTDLSENDKHN-KIPVNAVKPHTSSPGLVKPSSTSSLLKTAV 72
5_pfamImport    1 SSPLPTNGISGSP-ESFAsslD------GSGHAGPEGSRLERDENDKHSgKIPVNAVRPHTSSPGLGKPPGPCLQPKASV 73
7_pfamImport    1 CSPRPTNGISGSP-ESFPspvD------GSGLLSSEGSRLEADENDQLGgKVPVNAVRPHPGSPGLGRPPGPCLQAK--- 70
3_pfamImport    1 SSLSPSIEIGGSP-ESFPgp-------lGAGLLGPESSCSKQVRNDKQGiMIPINSVRSHTSSPGLGKPSRPCVQSKAAV 72
gi 513227769  189 SSPPPTNGIGGSP-ESFPspvD------VNLHAGPESSRTELSENDKHN-KIPVNAVKPHTSSPGLVKPSSTSSLLKTAV 260
gi 620986007  150 SSPLPTNGIGGSP-ESFPsppE------AGTLPGPEGSWTDLGENDKHS-KIPVNAVRPHTSSPGPGKPSSTCSQGKAAG 221
gi 556957928  178 SSPPPTNGIGGSP-ENFP---SplgvttVNAHTTSEKSRPENHENDKHS-KIPVNAVKPHTSSPGLVKPPSTSSLLKTAV 252
gi 62859431   178 SSPPPTNGIGGSPpENLP---S------P-LDGGLQSNRLEPAENDKHG-KIPVNAVRPHTNSPGLVKHPSTSSLLKAVV 246
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158706142  244 LQQ-AR--VD-SGGQHQPKSPRYSS-SPRSATHE-TMAKRSTTYAPKGT-LSSPSLNS------AQVPSPLP-TLQPLTS 309
15_pfamImport  73 LQQhDK--LEeTTGSHQPKSPRCSSfSPRNVRHD-TFARQHTTYSPKDS-MPSPSQRSqfl-dtAQVPSPPPsLMQPSTP 147
16_pfamImport  73 LQQhDK--SEeATGPHQPKSPRCSSfSPRNVRHD-TFARQHSTYSPKDS-MPSPSQRPqla-daAQVPSPPPsLMQPSSP 147
5_pfamImport   74 LQQlDR--VDeTPGPPHPKGPPRCSfSPRNSRHEgSFARQQSLYAPKGS-VPSPSPRPqal-daTQVPSPLP-LAQPSTP 148
7_pfamImport   71 --------VEeTPGPPHPRAPSRCSfSPRNSRQEgSFARHRSPYTPKGS-VSSPLPRPsvl-eaTQVPSPLP-PAQPSTP 139
3_pfamImport   73 QQQlER--ADqTSGPPHPKGPPRSSfSPRNSRHKgSFARQRSPYSPKGS-VPSPLPRPqsl-dvTQVPSPLP-LAQPCTH 147
gi 513227769  261 LQQhDK--LEeTTGSHQPKSPRCSSfSPRNVRHD-TFARQHTTYSPKDS-MPSPSQRSqfl-dtAQVPSPPPsLMQPSTP 335
gi 620986007  222 LQPlDK--PEeAAGPHQPKSPLC-SfSPRNARPE-TSVRQHSTCAPKGS-VPSPSRRPqvldpsRAVSSPPP-------- 288
gi 556957928  253 LQQhEKlaLEaSVGHCPPRSPRCVSySPRNLKQE-AAAKRPTTCAPKGAvSSPSVSSQvl--diAPIPSPLP-LAQPSTP 328
gi 62859431   247 LQQhSG--GLeDVLSHQPRSPRCSSfSPRGTRAE-LATRQHTTYAPKGS-APSPSQRLpg--vdSAHQSPL----HPSTP 316
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158706142  310 PAQVCISDGPSSVGLEGSLHLHRS-S-DRVSQPPHSTATLe--PLS---GALLATH---------GLEGL-ETKAEREG- 371
15_pfamImport 148 PMPAKRLEFSQQSVSEVSQHWQEQ-QvPSDSQHRHTAGTL---PQHtspSCKTSSHpgeslmshiGFSQD-ASKMDSDD- 221
16_pfamImport 148 PLPAKRLEFPPQAAPEAQQHWQEQ-QgAPEGQHRHTAGTL---QQHtapGCK--GHpge---sqlGFPQD-TSRMDSDD- 216
5_pfamImport  149 PV--RRLE--LLPSAESPVRWLEQ-P---ESHQRLag-----------pGCKAGLSpaepllsraGFSPD-SSKADSDAa 208
7_pfamImport  140 PV--RRME--LLPSAESPARWPEQ-P---EGHQRLag-----------pGCKAGLPpaephlpvsGFSPD-SSKADSDAa 199
3_pfamImport  148 PV--RRPE--LLPSAESPVHWLEQ-P---EGHQRLag-----------pVCKAGLSpaesilpraGFSPD-SSRADSDAa 207
gi 513227769  336 PMPAKRLEFSQQSVSEVSQHWQEQ-QvPSDSQHRHTAGTL---PQHtspSCKTSSHpgeslmshiGFSQD-ASKMDSDD- 409
gi 620986007  289 PVATKRLEAGQQPGPEASQPWQEH-L-SSESHHRHPAGTp---LQPpapGCKVSLPpgeppmlriGFSPDaASKMDSDD- 362
gi 556957928  329 PILAKRPEAPLQLESDESQLSMGQ-V-ATESHQHNVVGTAl--QQLplhGSRVSPHrdptttqhsLGFAS-DSSKVDSDd 403
gi 62859431   317 PATAKRLESPRQDRISSPHKPVEQlP-STDCHQVLPRTSQqhtPRSslvDSQTPr---------tGFSPE-SSKVDSDD- 384
                         250       260       270
                  ....*....|....*....|....*....|...
gi 158706142  372 ASSNSDGKKRKKYRPRDYTVNLQGQSSEDRTKP 404
15_pfamImport 222 AASGSDSKKKKRYRPRDYTVNLDGHVTEGGVKP 254
16_pfamImport 217 AASGSDSKKKKRYRPRDYTVNLDGHETDGGVKP 249
5_pfamImport  209 SSGGSDSKKKKRYRPRDYTVNLDGQVAEAGVKP 241
7_pfamImport  200 SSGGSDSRKRKRYRSRDYMVNLDGQVAETGVKP 232
3_pfamImport  208 SSGGS-GRKRKRSQPRDYTVNLGGQVAEAGVKP 239
gi 513227769  410 AASGSDSKKKKRYRPRDYTVNLDGHVTEGGVKP 442
gi 620986007  363 AASGSDSKKKKRYRPKDYTVNLEGQVVEGGVKP 395
gi 556957928  404 AASASDNKKKKKYRPRDYTVNLDGQLIEGSVKP 436
gi 62859431   385 ATSGSDNRKRKKSRLR---TEFEGHSADGTGKP 414
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap