Conserved Protein Domain Family
DUF4674

?
pfam15719: DUF4674 
Domain of unknown function (DUF4674)
This family of proteins is found in eukaryotes. Proteins in this family are typically between 126 and 221 amino acids in length.
Statistics
?
PSSM-Id: 318020
View PSSM: pfam15719
Aligned: 15 rows
Threshold Bit Score: 112.152
Threshold Setting Gi: 321478117
Created: 31-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 143833189  27 WAYSSTHEDNSTFQ-ETCPHCFQLLVLDNSRVRLKPKAKLTPKIQKLLNREARNDT-LSFKEAKLLRKYKDST-SVLLIT 103
gi 395510710  27 WLYHSSQDEKTVSE-GQCPYCYQFLVLDRYRVRLKPKPKLTPKVKKLLTRESKNCR-LTFKETKILKKYWDSK-SILLVT 103
gi 620947854  27 WTYSVSHADKKKSK-DVCPYCFQFLVLGAYRVRLKPKPKITPRLRKLLKREADGTRmLSFKQRKMLSRYKNSQ-STLLIT 104
gi 327275063  27 WTLSNIEGKKQENAgRVCVFCYQLLLPGNYRVRLMPKIKITPRIEKLLYRERKNYR-LNLKQTKILKKYKEST-NVLLIT 104
gi 573896303  31 msqqqeKDGGLRNR-LICPFCFQWRLPGNHRVRFKPKQKSNLQIQKIIKMEAAQKT-LSLKQMKILRRFRNST-STMLVT 107
gi 321478117  42 LTNVGVKFRKVSKS-NICQSCGNPWSMGKYKLELKKTFK-TAKIQKVLKKSKNSKK-ISSFNKHILERYSESK-CNLLIK 117
gi 218751890  48 skTLELPNQNFGPS-VMCSHCGSLWSKNESQIRILPGKNPSKSVKEIIKSCSEDNK-ISRFRATLMKKSLRNKmNKVVIK 125
gi 156717680  28 sirinsEKNNGSIE-NICPFCFQLFMPDNYKVRLKPKLKISPSIERLLKKEAKNHR-LTLKQTRLLRKYKLAK-SMLMVT 104
gi 823456542  34 lylsvgNERGLG---RICPYCFQFLVPDSYRVRLKPKMKVTPQIEKVLKREAKNYK-LNMKQTKLLRKYRESR-SILLVT 108
gi 513171236  26 WTLSSCRDEEFGKE-RICPYCFQFLVPDSYRVRLKPKMKVTPQIERIIKREAKNYR-LNMKQIKLLKKYRDSK-SVLLVT 102
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 143833189 104 CRTCNRTVRHHGKSRSFLWALKSNAATAANKASPKTPK--R-----TAPGSA-----N-----LGQ--STNGSKGKSPSL 164
gi 395510710 104 CKACNKTVKYDGKSRSFLAEMKNNLSTPKIQSVLKTPD--IkssgsTKKKKK-----S-----FSS--NKPGSQNNSPAL 169
gi 620947854 105 CPSCNGTIRQKGTSRSFLEALPGSRNTPKTRPGQKVPD--G-----KTVKSAsktnyS-----FSH--NPSNSKGSSLAL 170
gi 327275063 105 CNVCGKTARHKGSSRR----TSWNKTTPASRSQP-------------------------------------GSKRETPFS 143
gi 573896303 108 CYNCNKTSRQGGVSRDFLTGFSKNLNTPRSATRQKTPG--L-----TPQSAS-----K-----ASTplPKSASKGKSPAG 170
gi 321478117 118 CGSCFKQTAFP---------------TPLPPKEVKSVK--R------IPLSS-----D------NH--EKKKCKKIKPAA 161
gi 218751890 126 CSVCSKNTQI-------------SCTKPVRPKPKKEDN--------KEVANV-----R-----KKK--KKKGKD-KTAGL 171
gi 156717680 105 CSTCSKVSKYAGESRHLLA---NGPGTPKTLRVNASTDlrI-----RTPGSS-----RktnlsHSE--EKLSSKGKSPVL 169
gi 823456542 109 CKSCNKTTRYYGESRDFLAAKTQNCGTPGIKSSLKTPD--V-----KIQSAK-----Kmt--pVSC--SWLGSKGNTPSS 172
gi 513171236 103 CNSCNKTTRHYGKSRDFLATKTHNSGTPTIQSSLKTPD--V-----KIQSAN-----Kat--pASC--SRLGSKGNTPSS 166
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 143833189 165 TIRT------PTSGQSTP-I-CSSRNGSK--------RK---KHFS--QLKALLS-----------QSASDKNPKLDFRH 212
gi 395510710 170 IFRT------PTSGQSTP-D-SASKSLSK--------MK---RHLS--QLKMMLN-----------SEESQKTPSKDFRN 217
gi 620947854 171 PFRS------SSG-RSTS-I-SSSKDHNK--------KK---QYFS--QLKMLLK-----------SEEAPKKGKGDFRN 217
gi 327275063 144 SPRI------STSGQSTP-G-SSSRTPKN--------AK---AHFT--QLKRLLC-----------LEEEKQTNKKGLKS 191
gi 573896303 171 TPRS------ASSAPASS-S-SSKSASAK--------KF---AF-S--NLKRLLV-----------LEENEKNKKGGLQD 217
gi 321478117 162 VSNQ------NNPGKQQE-KlQKSKPPSKptkvtkpgKK---QQFSrnQLKNISK-----------TISNNASVKGSLQS 220
gi 218751890 172 KISTmktpdvTEKKQVEPvV-STPISINV--------KKpkgKQVT--SVQKVRKinlnklnnvlnDSKVQKSRS-SFNN 239
gi 156717680 170 TPRS------CVSAQSSP-A-TPAKSSKK--------GK---FQFS--KLKMLLS-----------QEEREPSKKGNLQN 217
gi 823456542 173 LSRT------RESGHATT-N-SASKTPRN--------SK---FHFS--KLKRMLD-----------LEEKEKSQKADFKS 220
gi 513171236 167 LPRT------CVSGQATT-S-SISRTPRN--------SK---FHFT--KLKRMLN-----------LEEKEKSQKVDLKS 214

                 ....*
gi 143833189 213 FLSSL 217
gi 395510710 218 FLSSL 222
gi 620947854 218 FLLSL 222
gi 327275063 192 FLLSL 196
gi 573896303 218 FLSSL 222
gi 321478117 221 FLSSV 225
gi 218751890 240 FLKEL 244
gi 156717680 218 FLSSL 222
gi 823456542 221 FLTLL 225
gi 513171236 215 FLTSL 219
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap