Conserved Protein Domain Family
DUF4675

?
pfam15720: DUF4675 
Domain of unknown function (DUF4675)
This family of proteins is found in eukaryotes. Proteins in this family are approximately 190 amino acids in length.
Statistics
?
PSSM-Id: 318021
View PSSM: pfam15720
Aligned: 11 rows
Threshold Bit Score: 231.258
Threshold Setting Gi: 532077466
Created: 30-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 831214518  118 EKQASSCPVVLCPDVVPSPQHPARSLSERHCESQGWLLQFDRQAPGRISTSPTLRRLRGSGCGTLHSLPQQEGLQVPTWG 197
gi 545205946   76 GKTESSCRQLQPRGFGASAQPLLKSLSKKHCENQGNLLHFDRQAPGRISTSPTLRRLRGSGYGTSRLLPQQETVEVPTWG 155
gi 1040220542  53 GKAEPSCPEMQPQPMEASPQLSSRSLSKQHGESQGNLLQFDRQALGRISTSPTLRRLRGSGWGTLGSLLQRDALDTRTWG 132
gi 731457881   30 GNTESPHPEVQPRGSGASPQPLLRSLPRKHCENQGSLLQFDRQAPGRLSTSPTLRRLRGSGSRTWNSVPQQNTLEVPTW- 108
gi 351699699    2 QKVESSGPEVQPQGCGPSPQRPL-SLSKKHCENQGTLLQFDRQAPGRISTSPTLRRLRGSGRGTSFSLSQQDALEVPIWG 80
gi 884933252   55 vrkAVSDPQGQTQGCG-SPQQPL-SLSK----NQGTLLQFDRQAPGRISTSPTLRRLRGSGRGTSSSLPQREALLEPIWG 128
gi 532077466   56 gRTESSCPETQPQGCGTSPWGPW-NPSKKLCENQGNLLQFDRQAPGRISTSPTLRRLRGSSQGSSISPPHQDVLDVSTQK 134
gi 296212500    2 EKTESLCPEVPARGCRAFPGHLLRSLPKQHCENQGSLLQFDRQAPGCISTSPTLRRLRNRGCGAWHSLPQQDALQVLTWE 81
gi 426373671    9 EKTESFCPEVPPQDCGASPRSSLRSLPK----NQGSLLQFDRQAPGRISTSPTLRRLRTRGCGT-----RQDALQVPTWG 79
gi 558103966   56 GKTEQSHPE-QPQSLEACPLHPQGGLSRKPCENQGSLLHFDRQAPGRISTSPTLRRLRGNGCGTRHSLPQQETLEEPTWG 134
gi 440897245    2 EKMEPSRQEVQPAACKASPPYSLESLSKKHCQNQGNLLHFDRQAPGRLTTSPTLRRLRSRGCGSV-----RGALEVRTWC 76
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 831214518  198 SWGESVGCTHYLSKSLPGHPEAPPHSLSSWRLRS-KLPSDPEQTLDTADSFKLQTRPTDQCVLPELQSTDKESLHQASLP 276
gi 545205946  156 SWKELAGSPCYLSKSLPGSPKDSSHSLSPLRLHS-GSPTDPERALSAADPFDPQMQPTDEDALPVLPLIEEGSLPQASLP 234
gi 1040220542 133 SRREPADSPDYLSKSLPGNPKDSPHLTSTLKPSP-RLLSTPESTLSTADSIKPQAKPSVGRALPMLQTISEQPLLQASLE 211
gi 731457881  109 --KEPSSSTCYLSKSSPESPKDYSPCISSLRLSDlRLPSDSGRVLNTAGSVEPQIGPSDKQAPPRLQPINKGTFHHAS-- 184
gi 351699699   81 SWRALAGSPGHLPKSPLGSPKDSPHSLYPLRPRS-G-HADPKGALNT-DSMESQTRSPDEDPLPVIRPINEPSLHQPSLP 157
gi 884933252  129 SGRVLAGSPGHLPKSPLGNPKECPHTLYPLKPPS-GPPADLKGALNTANSVEPQTKCPDEDPLSVPQHISETSLCQPSLP 207
gi 532077466  135 SWRDPTGSPGHLSQSLPGSPRDSSPSLSPLRSRS-GRLSDPESTLSTADSFKSQTRTPDEHVLLAFRPIDEGSPHRASLP 213
gi 296212500   82 GWREPAGSLCYLSKRLLGSPKDPSYLLSPLGLCS-RLTPEPERALNTADSLEPQTRPTDQYVPLELQPVNEGSLQQVSLL 160
gi 426373671   80 SWGAPVGFPCYLLKSLPGSPKDSSHLLSPLRLHS-RLTSEPERALNAADSLEPQTQPTDKYLPPELQPVNEGSLHQASLR 158
gi 558103966  135 GRKEPAGSPCYLSQSLPASPPNSSHSLSTLRLGS-RLPPDPKRILTTADSSEPQTRPTDEAAFPVLQPVQEGSLPRTSFP 213
gi 440897245   77 DLQEYPGSASPLSNKVCESTEESSHSVWPLRLHS-RLPLDSERALDSAESIELQMGPGEERALPVPQDLEEGSHPQASFP 155
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|.
gi 831214518  277 GQEAHSPPRPTLRCPGPQ--GEESRPSRYVCSCFLQCYDIY 315
gi 545205946  235 RRGGHSPPSPAPQAPSPQ--GEELPRSRCVCLYFLQGYEVC 273
gi 1040220542 212 EQKDHSLLSLTPLHPSPQ--GHRVPRrvllmvkgedkedkw 250
gi 731457881  185 -----PPPSPAPSCPSLQ--GEALHQSRX-CIYFLQCNEIC 217
gi 351699699  158 AQEDHGLPSPTPQHPNPQ--GEESHRSRYVCTDNLQCDAIC 196
gi 884933252  208 RQEGHRLPSPISQHPRAQ--GEESHGSRFYEHRRSSVvlnl 246
gi 532077466  214 GQEGHSTPSPTAGSPRPQ--VTQI----------------- 235
gi 296212500  161 QQESHFLPSPTPRCPSPQ--GEELYPSRCVCIYVLWCYDIC 199
gi 426373671  159 HQEGHFLPSPTLRRPSPQ--GEELHPSRCVCIYFLWCYDIC 197
gi 558103966  214 GRGSRSL-SPAARPPGPQ--VTALsplplspwaaeqhrppc 251
gi 440897245  156 RKGDHSAPSHTPGPPGPQfiSERRIASVQVCLYFLQCDESC 196
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap