Conserved Protein Domain Family
MIIP

?
pfam15734: MIIP 
Migration and invasion-inhibitory
This family of proteins binds to insulin-like growth factor binding protein 2 (IGFBP-2) and inhibits the invasion of glioma cells.
Statistics
?
PSSM-Id: 318031
View PSSM: pfam15734
Aligned: 17 rows
Threshold Bit Score: 344.832
Threshold Setting Gi: 156404005
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 172045714    47 SSSSNNLEMPLSQETSASSV-APNSQDKRHVwDPLDSHRGDTYDVAWYGKVNSRVDSLPPATCQHQEPQEGLRPSSvp-- 123
gi 914897728    80 SCNIYDSETPLSPETSSISWqASCSKDRCHKwDPLDTHGDDPCDVAWLDRVSPRVASQPPVKGQHLEPLGQPRFYS---- 155
gi 260819124   115 EVSRPGGQLQDTVQGVERLPrFHSTPLREDGgKVLTAATQDVEDDTFPTGESTRHLLSEHLAGQESSLRVDHEPHTph-- 192
gi 156404005     9 TGPSPHSRLRSVNNALLRSLqENQEKVRSILnDMSYKPRDYTRSFSADSSFTVRGLDRTPVAVRKIDSMAAYSKTSsstp 88
gi 329663978    43 SSSSYDSEMPSSQEMSSVASrASCPQ---------DAHPGDPCGRYWPGDASSGMNSLLPATCLYRESLGPPRPHSap-- 111
gi 953846837    43 SSSSYDSETPPSQEMSSMASrASCPQ---------DAQQGDPCDMSWPGGASSGGSSPPPTKCRHQESLGPLRPHSap-- 111
gi 444728169   863 SSISSNSETPSYQETCSTSSrTYCPR------DPLDAFQTDPRDMTRPG--LSRAASLPPAKSQHQQYLGRPRPHSap-- 932
gi 224586904    43 SSSSYNSETPSTPETSSTSLsTSCPQGRSSVwGPPDACQGDLRDV-----ARSGVASLPPAKCQHQESLGRPRPHSap-- 115
gi 395840992    41 SSNNDNTEMSRSQKTPSASSrASCPRGKCHPkGPPDAHQSDPFDV-----ASCKVAALQPAKCQHQESLGQPRSHSsp-- 113
gi 1040118379   43 PSSSYNSKVSLSPETSSSSSrACSPP---------DVQQADPSDVASLGRVSSRVTSLPPARRQHQASLGQPRARSap-- 111
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 172045714   124 ------lL--ATEGLKRPVSLGGPKGlgpdkaQVPRSLPLRLGKLSK--PKVTf-----SQESSVPESSWYSRPCLDYDW 188
gi 914897728   156 -------L--TTIDPKEPAPLSGLCD------RVPRSILAEQSEQSK--SRVT------CQEPATPESSWSLQPYLGYDW 212
gi 260819124   193 ------lY--DEGNNRRAKETTKVPGsilrtpVKRRTMVGGGSNHGNq-SAMTv----gELQAQGREDD---QPLLGYDW 256
gi 156404005    89 ksfkdalR--ETGNDRRNRKDLGLDKtp--saSILLTPANRAKKTPKkgLRVSfqt-sfDKERDNIDDDLNRRSLLGYDW 163
gi 329663978   112 ------lL--AISDSSDPELSAELDSpgtqeaQALRSILAQQGKLSK--PRVT------NKESPVPEKSWRLRPYLGYDW 175
gi 953846837   112 ------lP--ASSDSNDPELSAELDSllq-eaQAMRSAPDQQSKLPK--PRVTf-----KKESPVPERIWRLRPYLGYDW 175
gi 444728169   933 ------lP--TTSDLNDPEPVAGLNDlglqkaQVLRSLEARQSKPSK--PRVTfceeqsEEESAVPEKSWRLRPYLGYDW 1002
gi 224586904   116 ------sL--GTSSLRDPEPSGRLGDlgpqeaQALRSILAQQSKLSK--PRVTf-----SEESAVPERSWRLRPYLGYDW 180
gi 395840992   114 ------hLkaATSDLKDPEPSAGPGDlgpqeeQSLKSVLAQGSKQSK--PKVTfc--eeSKESVLPDRSMHLPPHLGYDW 183
gi 1040118379  112 ------lL--PITDSRDPEPSAGQGDlgsqeaQAPRPVLAQPSK-------STv----tCEDSEVPESSWRLRPYLGYDW 172
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 172045714   189 TAGSLDSSSPVSSESEAYFSMLQRFREDNREDCVC-N-SPE---------AVFPE----LQESS--GVEEDHECVYCYRI 251
gi 914897728   213 IVGSMDSSSSITSKPETFFSTLQKFRETNKEECVY-S-TPE---------PQFLG----LCDGS--DVEEDHECVYCYRV 275
gi 260819124   257 IAGLLDNDASSLDRSEGFFEELREFRRVNREECEH-KaTLEvk------tPQFSRhkspLPPAG--ASDDTHDCVHSYRL 327
gi 156404005   164 IAGILDNESYLAEKHDDFFDDLKEFRRVNKQDCFSqA-LPDslltpyrttPRKIN----EEFEE--EKE-VYTCANTYRL 235
gi 329663978   176 IAGSLDNTFPVTSKPEAFFSKLQKFREANKEECIC-S-GPE---------PQFLG----LQESd--AVEGDHECVYCYRV 238
gi 953846837   176 IAGSLDNSSPVTSKPEAFFSKLQKFREANQEECVC-S-DPE---------PQILG----LREGg--GVKGDHECVYCYRV 238
gi 444728169  1003 IAGSLDNTSPVSSKPDAFFSKLQKFRESNEEECVY-S-RPR---------SQLLG----LHEGt--VVEDDHECVYCYRV 1065
gi 224586904   181 IAGSLDTSSSITSQPEAFFSKLQEFRETNKEECIC-S-HPE---------PQLLG----LRESsgsGVEEDHECVYCYRV 245
gi 395840992   184 IaGALGNSSSVTSQPETFFSKLQEFREANKEECIC-R-YPE---------PQFLG----QPESs--NVEEDHECVYCYQV 246
gi 1040118379  173 IAGSLDSSSPVTSKPEAFFATLQKFREANKKECTA-S-HSE---------PGFLG----LHENd--GVDGDHECVYCYRV 235
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 172045714   252 NRRLFPEPLD----PGAPCCLCGIPRDEQGPQTLVEPVQVRVSIPLSIMDPPHQYRIHRRKSFDASDTFALPRHCLLGWD 327
gi 914897728   276 NKRLFLVPLD----PGIPCRLCGRPRNPQSPRTLVQSTRVRVSIPLSILDPPHQYRVHRRKSFDASDTPALPRHCLLGWD 351
gi 260819124   328 NSRLFPTPMHsnfaGDSECAICKSTRSGE--ETLESPAYVRVSVPRSSLVNSLRVKPHRKRSFDPSDTVGLSGHTLAGWQ 405
gi 156404005   236 NERLFAERVHe---PDVACSVCK---SQPKPEYESEGSYVRVSVPRSTLQSPYKIKPHRRVSFDPTDTIGLSSHCLAGWE 309
gi 329663978   239 NRRLFLVPAD----PGTPCRLCRKprDQRgAGTLAEPAQVRVSIPLSVLDPPHRHRIHRRKSFDASDTLALPRHCLLGWD 314
gi 953846837   239 NRRLFLVPSD----PGTPCRLCRTprDQRgPETLAEPAQVRVSVPLSVLDPPHQYRIHRRKSFDASDTLALPRHCLLGWD 314
gi 444728169  1066 NRRLFLVPVD----PGTPCRLCRTsrDQQgPKTLKEPAQVRVSIPLSILDPPHRYRVHRRKSFDASDTLALPRHCLLGWD 1141
gi 224586904   246 NRRLFPVPVD----PGTPCRLCRTprDQQgPGTLAQPAQVRVSIPLSILEPPHRYHIHRRKSFDASDTLALPRHCLLGWD 321
gi 395840992   247 NRRLFVVPLD----PGTPCRLCRIprSQRdPKTLEESAQVRVSIPLSILDPPHQYRIHRRKSFDNSDTLALPRHCLLGWD 322
gi 1040118379  236 NRRLFLVPSD----PGTPCRLCGTlrEQQgPETLLEPAQVRVSVPLSILDPPHWYRIRRRKSFDASDTLSLPRHCLLGWD 311
                          330       340       350
                   ....*....|....*....|....*....|....*..
gi 172045714   328 ILPPKSEKTSVPKSLDLWSSVShGAaQRRNLSATNPS 364
gi 914897728   352 ILPPKSETSTAPKSLDLWSSIS-EA-QHQELSPSSSR 386
gi 260819124   406 --NSCPSTIPAASNLDLKSSVRfQP-GARSMAPSVSV 439
gi 156404005   310 --SSKPAVVPPQSSLDLKASL--------HHSRATLD 336
gi 329663978   315 iiPPKSEKSSAPKTLDLWSSVspea-hhqKLSATSCP 350
gi 953846837   315 ilPPKPEKSSAPKSLDLWSCVsaka-qhrKLSATSPS 350
gi 444728169  1142 ilPPKSERSSAPKSLDLWSSVska--qhfRLSASSPS 1176
gi 224586904   322 ifPPKSEKSSAPRNLDLWSSVsaea-qhqKLSGTSSP 357
gi 395840992   323 ilPPKSEKSSALKSLDLWSAVssga-qhqKMSATRPS 358
gi 1040118379  312 ilPPRSEKGSAPKSLDLWSSVfata-qhrKLSAASPS 347
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap