Conserved Protein Domain Family
DUF4684

?
pfam15736: DUF4684 
Domain of unknown function (DUF4684)
This family of proteins is found in eukaryotes. Proteins in this family are typically between 531 and 1277 amino acids in length.
Statistics
?
PSSM-Id: 318033
View PSSM: pfam15736
Aligned: 7 rows
Threshold Bit Score: 185.164
Threshold Setting Gi: 927145480
Created: 30-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034557837  981 GQQFLHEKCQTWVQVHLQGLQKVVFRSWQQAAAHQRCTVTRPEQLLLQSYFQAWCEVVRDTGVLRAQHQAFQDGLRRRAL 1060
gi 831231551   787 RQQLLCEKYQRCVQVRLQGLRRAMFWGWHQAAVHRRHTLAQPEQLLLHSYFQAWYEVVKAQRVPPAQHRNVQHGLRRRVL 866
gi 1040118333  830 RQQILHTQYERWARIHLQNLRRAVFQGWRQAAARRRRV---------QSHFLASCEVARDTRALRAQRGALQDSLRRRTL 900
gi 965962429   988 RQAFLQEKCQQWMQARFQGLQRAMFWGWQQAAARRRPVAASPEQLLLQSHFQAWFGVVKAS---WAKHPAFQDGLRRRIP 1064
gi 927145480   877 RQQLLREKYQKWVQGRLWGLRGAVFRGWRQVAAHRRATAASPEQVLKQNHFQAWGGFVRDIRTLQATCAAFQDGL-RQAP 955
gi 940770209   855 RQQCLRDRYQGWAQLRQQGLRRATFQSWRQAAAHQRHRMARPERLALQSHFQAWCGPARDAGTLGARCRAGQAGLRRRAL 934
gi 752415142  1087 GQQALHAKYQRWVQVHLQALRRSVFRDWQRAAARRRHPVNPPEQ-LLHSRFQAWCGAVRDTGVVPVT-GAVQDGP-RKAV 1163
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034557837 1061 GAVFATWREAQEVAAGAQEQRVAQASLARWRSCGQQGQEDGQQ-KKARAPQAFPAWPVAPGMHHEAQQQAGESAGAQAaq 1139
gi 831231551   867 LVTLPTWQEAPAATAQVQEQLMAQASLGHWRSHVQRGRADRQLrRRAWARQAFRAWQVALGQRREAQQQAGCRTGALV-- 944
gi 1040118333  901 GAAFATWREAQAAAARGQEQRVAQVSRACQGGLGQWVWTNRQL-WGAQTQQALGAWREALGQHQEAQQQAEGRAGARAh- 978
gi 965962429  1065 RATFAS--EAPAITAQPQELHMAQAS--CWKSREQGCQADRQL-RRTWAQQAFVAGRVAPGQCCKARRQAGERSRAQ--- 1136
gi 927145480   956 GATSAMWWDTPVAAARPQAQHVARASFS-WRSHVQGRQMDGQL-RRAWAQQASLARrqrpsplphlpapaaaaqrpqgqr 1033
gi 940770209   935 GAALAAGQEARVAAARAREHHVARASIALWRSHVQGGRADRQL-RRARAQQAFMAWRVALGQRCEARQQAEGRARAQTq- 1012
gi 752415142  1164 GATSAMWQDARAAKAWAWEQRVARASVVRWRSHAHGGRADRQL-RRARAQQAFIVWRAALGRRCKAHQLAEERP------ 1236
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034557837 1140 cwTWCWALWVHESCRGQVSRAHASWKPRAWVLEASVQSAVRGGVQRAILTQLRPAELRRFLRT--VQLRVrlGL------ 1211
gi 831231551   945 --TLHWTLGMCQPSCGQVSRAHAAWRLSAWVLEAWAQLVAQDHVQRAAVTQLQQTGLRSLLRThwVLLRVh-SR------ 1015
gi 1040118333  979 -vALHWTPWVHEARLAPTSPAPAAQTLSAWVPEALAQSATHSHIQRAATTRFLQAGLGGLLQThwAQWRT--ALfrarle 1055
gi 965962429  1137 --ALGWMLWARESCQHRVIRDHTVPTLSARVQETWTKSATQGHVQRSAVTHVQQAEPRCFLRThwSQWRT--ALfrvwle 1212
gi 927145480  1034 rgqknvaekevpaalap--------------------------------------------------------------- 1050
gi 940770209  1013 -lALCWTLWVHESRLHRLSRAHAARKLSARVLEAWAQSAAQGRVQRVAIARFEVVGHRQLLWThwAQWRTelLSvwlepr 1091
gi 752415142  1237 --ALCGTQWVHESRPRRVSRARAAQKLSARVLEAWARLAARGRVQRASITQFQQAGSRRLLWThwAQWQA--AL------ 1306
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034557837 1212 ------------------------PGA--------------------------------------G-------------- 1215
gi 831231551  1016 ------------------------PQA--------------------------------------Eaqeastaysrtqad 1033
gi 1040118333 1056 rraraqeaerrlwpgsfpllldtpDPW--------------------------------------M-------------- 1083
gi 965962429  1213 pqaevqeas-rahparpraslrrwPGL--------------------------------------T-------------- 1239
gi 927145480       --------------------------------------------------------------------------------
gi 940770209  1092 meaqets----tahprpradlthwPGL--------------------------------------Agrgrllal------ 1123
gi 752415142  1307 ------------------------LSMqlepqaeardapkvdvrqwprvasgghvlalmhtpapwK-------------- 1348
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034557837 1216 --------------------------K----------------TRSCWTQATEL-VPPAPSLQCSLGGRRKPRGTAWAQR 1252
gi 831231551  1034 fmhwprmtswghlllmldtsapwkevK----------------TFSCWTQATGP-VLPEPTLQHSLGGQKTQKETPWAPS 1096
gi 1040118333 1084 --------------------------Q----------------TLSSWTPAAGPtVLPGPTHQHSHGGRTPPGKMAWVQ- 1120
gi 965962429  1240 --------------------------TrgrllvlmnppalkrqTRSCRPWAMG----PSPTQHRSPSG-RMQGEASWAQS 1288
gi 927145480       --------------------------------------------------------------------------------
gi 940770209  1124 ------------------mdtaapwkQ----------------TRSCRPQGTGP-RLPSPAQHRSPGGQRKRRETSWAQS 1168
gi 752415142  1349 --------------------------Q----------------THGYGT-------LPSPGQHHSHSGQRKQREMSWAQS 1379
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034557837 1253 CREHSLC----------PAFQLWPqwpgqssWVPGlplwTRDQGPRAHSSPEPRACKAQSKAHK---RRLrArscr-ile 1318
gi 831231551  1097 NREHPQG----------PAFQLCG-------WAPG----LPPTGPGGQCSPEPRALKGQGWAHQ---RRL-Gagsyrvlg 1151
gi 1040118333 1121 -----IC----------PAFQLWLpwpgdgsSAPG----LSPTGPGGPWSPETRALQGEDGNNGrdpRRL-Rsl-----d 1175
gi 965962429  1289 DSQPSLS----------PTSQLQLqgprcacWAQD----QCPAGPGGDCSSETRDLEGKT-------RHL-G-------- 1338
gi 927145480       --------------------------------------------------------------------------------
gi 940770209  1169 KETCPCArtmyevqgcdSAAQLWMqrp--gpRAQG----RPPPGPGGDCSSE-------GQVDK---RRL-G-------- 1223
gi 752415142  1380 KETCPwgqtshrpgnpltatwqicftygfc-------------------------------------------------- 1409
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034557837 1319 KQAQAHGsalllalKGHDALGHQEEVPAAPVPRGTASRAAGFPAGQVPGSGMAALGGCPRGRAAGADPAQGVAPEMGLAD 1398
gi 831231551  1152 GQAXASGcvlllamLALDALGRQEQVPAALASXGSASPAAGFPAGXVPGSNMAALGGCSRRXAAGTVPAQGMAPKMGLAE 1231
gi 1040118333 1176 EQAQVRGl------KGERTRSADRGQHIQRWRSEAAXPVPGFPEGQVPGSCVAALGGCPRGRAAGADPASAVAPGMGLAD 1249
gi 965962429  1339 ----------------------------CPA-----APAAELPAGQAPGSCVAALGRCSGGGEAGMDTAQAVAPEMGLAT 1385
gi 927145480       --------------------------------------------------------------------------------
gi 940770209  1224 PSVGMPTgp---lsPGGNTCDAGTWRPCSAGSRAPS-------S-QAPGRDMAMLGGCSGGRGAGAVTGEwggalapash 1292
gi 752415142       --------------------------------------------------------------------------------
                          570       580       590       600       610       620       630
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 1034557837 1399 VVAADPATASGSAVTAAGRW---------------------------AFKKWHQRLAARSPRRGAASSPRPWS 1444
gi 831231551  1232 VATADPKTSGGXAVTAARRWf-------------------------qAFEKWYQRLAARSPRRGATSSPRPLN 1279
gi 1040118333 1250 MAASGPAAARGSAATAAGRQ---------------------------ALEKWHQHLAAXAPRGGAPSSPKALS 1295
gi 965962429  1386 VAAAHPAVAGGSAVTESGGRlgpfpgtggrphlqqalpnrvtpghfqAFKKWYQGLAARGLRARASSSVRPCS 1458
gi 927145480       -------------------------------------------------------------------------
gi 940770209  1293 ailnpnpykevfpsvafgptqsetwdrprnlhcshtswcvapsswchrgaggrgehrcprrqppsvgpphpvp 1365
gi 752415142       -------------------------------------------------------------------------
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap