Conserved Protein Domain Family
UPF0492

?
pfam15744: UPF0492 
Uncharacterized protein family UPF0492
This family of proteins is found in eukaryotes. Proteins in this family are typically between 78 and 408 amino acids in length.
Statistics
?
PSSM-Id: 318041
View PSSM: pfam15744
Aligned: 11 rows
Threshold Bit Score: 430.753
Threshold Setting Gi: 82188134
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81905608   10 CGNFAVLVDLHVLPQGSNRDSSWFSEQKKEEVCLLLKETIDSRVKEYVGIYKQR-KPS-SAEFTRSSPLSLKGYGFQITA 87
gi 82188134   10 CGNYAVLVDLHILALGDQDNANWFSPAHRKEVGSLIRDALEPRVRQFQEARYQKiQSKpRKDLTPTAPLCLEGGNVRLAV 89
gi 847126327  26 CGNFAVLVDLQVLPQGTSKDTSWFSDHEKEEVCTLVRDTLDSRVKEYLDSRRQPgQLK-RKEYTQASPLILKGNRLRIAA 104
gi 114680935  10 CGNFAVLVDLHILPQGSNKDTSWFSEQKKEEVCLLLKETIDSRVQEYLEVRKQH-RPS-NAEFTRSNPLSLKGYGFQITA 87
gi 965910148  10 CGNFAVLVDLHVLPQGSSKDTSWFSEQKKEEVCLLLKETIDSRVKEYLQVRKQH-RPS-DAEFTRSNPLSLKGYGFHITA 87
gi 584075901  10 CGDFAVLVDLHISPQGSNKDTSWFSEQNKEEICLLLKETINSRVKEYLEVRKQH-RPS-NAEFTRSSPLSLKGYGFQITA 87
gi 831222849  10 CGNFAVLVDLHVSPQGSNKDTSWFSEQKKEEVCLLLKETINSRVKEYLGVRKQR-KPS-NAEFTRSSPLSLKGYGFQITA 87
gi 313661452  10 CGNFAVLVDVHILPEGSNKDTSWFSDQEKEEVCTCLEEVVVSRIKHYLEAPKQRgQWK-SMEHASSSPLFVTANNFHITA 88
gi 823457730   1 ---------------------masnkfviKEVCKLLEEVVASRVKRYLEAPKQRgQWK-TMEQGSSGPLFLTANSLHITA 58
gi 514473577  10 CRDFAVLVDLHVSPQGSKKDTSWFSEQKKEEICLLLKETIDSRVKEYLEVRKQH-KPS-NTEFTRSSPLSLKGYGYQITA 87
gi 655722749  10 CGNFAVLVDLHISPQDPNKDTSWFSEQKKEEVCLLLKETIDSRVKEYLEVRKQH-KPS-SPEFTRSNPLSLKGYGFQITA 87
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81905608   88 YFLKRGIHLHCIQNSQNTELRVFPERFVVCVSQLAFGhdiwANQNEKSTKKAL-HGVSDYFPECA--ES---SPSPGTKL 161
gi 82188134   90 HFMKRHVNLRCIVRQHYRELRVFPERVVVCASPPENS----ALPNGNLNLDVSeQSQSKYFSNSG--ETa-nPLQSSTAT 162
gi 847126327 105 YFIKRWVKLRCVVKRQYRELHVFPDRFVVCASQLEPAssvwVTEAAATLKESCsSGTSEYFAQPKgiEMt-nLL---TTP 180
gi 114680935  88 YFLKRGIRLRCIRSTQNAELCVFPDRFVVCVSQLAFSrdllANQNEDLTERVL-HGVSDYFAECA--ES---SLPPSAKL 161
gi 965910148  88 YFLKRGIRLRCLRGSPRTELQVFPDRFVVCVSQLAFSrdlsASQSEDLPGRAL-HGATGDRTGCV--EQ---LLPPGAEP 161
gi 584075901  88 YFLKRGIRLRCFGGSQRPELRVFPDRFVVCVSQLAFScd-lSRQNEELTGRGL-HGASGYFAECA--EG---PLPPSAKR 160
gi 831222849  88 YFLKRGIPLRCLWGARNTELQVFPDRFVVCVSQLAFGhnhlASQNEELTERAL-HGVSDYFAECA--ES---PLPPRAKL 161
gi 313661452  89 YFMKRWVNLRCALGKHYRELRMFPDKFVVCISKLEFNpsawTCENGAL--KEVsNGTSEYFAESA--ENrklKLSLNEQI 164
gi 823457730  59 YFMKRWVNLRCALGKHYRELRVFPEKFIVCVSKLDFDpsawTCDSGGL-KEELsSGTSEYFTESS--ENkklKISLSEQI 135
gi 514473577  88 YFLKRGIHLRCIGSSQNTKLRVFPDQFVVCVRQLAVSpgilANQKEELTERAL-HGVSDYFAECA--ES---PLPPSAKL 161
gi 655722749  88 YFLKRGIRLRCIRGSRNSELRVFPDRFVVCVSQLAFNhdllVSQKEELTERAL-HRVSDYFAECA--EN---PLPPSAKL 161
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81905608  162 KRNALKEIVRRTKSKgTDVSKPQPSG------DLVGRSSDSVITVVPWRR---DASA-----IllsE----SVGQAQddI 223
gi 82188134  163 KRAVLQKIARKTKIQpPRSQDNQESKtgqfqaDNAEKGSRSVLQRITRQAniqPQQC-----Q---DdqvyKSGQFQ--A 232
gi 847126327 181 TQAVLKNIVRKTKITkDISDEAERD-------SRMSPSLGLADTGKADANniqKALS-----KaqpEe--kRAEEPNdyI 246
gi 114680935 162 RRNALKEIVKRTETKsSVTSKSQTRR------DTVETSSDSVIAEIARRRndgQASS-----SppsE----SMGQAKdyI 226
gi 965910148 162 KRNVLQEIVNRTETKsSAVSGSRSNG------PSVGASSDSVAAEGAWRRwgrPASS-----Sp------pAVGQAEddR 224
gi 584075901 161 KRSVLKAIMKRAETKsSSTSKSQGSR------DIVGTSSDSVVAEMAVRRgdsQASS-----SappE----SSGQAEdcT 225
gi 831222849 162 QRNVVREIVKRSKTKsSIVSKSQTSR------DTVGTSSDSVITEIARRRsdgQAST-----SrlsE----FTGQAEdyI 226
gi 313661452 165 KQDILKEIVKRTKKGkNSVSKPQTSK------DSKKVDLGSLGSQTGNRKndcQTSP-----GpqsEvkwrSTGRLKncI 233
gi 823457730 136 KQDILRKIMKRTKPR-SSASKPQISK------DSKKVYLGWADSQTENRKndcETFL-----NarsAvkrrSPGLLKdcT 203
gi 514473577 162 KKNALKEIVKRTETK-SVSSKSQIPR------ATVGTSSDSEIAVVARR-----SSDcqtssSppsK----AVGQVKdyI 225
gi 655722749 162 KRNALKEISKRTETKcSTVNKSQTSR------HIVGPSSNSAMVEVARMx---QASS-----SspsE----STGQAKdyI 223
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81905608  224 RAAKSHQELPVQKLEN-VSqTQP-GDTRSQQQLHPGEWLKTGLLSRSPAYNYESASPGPKQSLRAAKTQQKHRNCGSVED 301
gi 82188134  233 DKQEKGSGDVLQKITRqAN-IQP-QQCQDDQESKSGQVQADKEENGSGDVLHKIAKQTNTQPPQSQDDQEFKSGQFPAGE 310
gi 847126327 247 NT-ENSLGLPVPKVENdVNhRQP-SEASSQQKPQCAE-LKTQDLSKHLSRLSDSAKQ--TQSLRASVMQQKRRRHSSEGK 321
gi 114680935 227 KAAESHWGLPVQKLEK-VNqTQP-EDTSGQQKPHPGERLKTGLLSRSPVCSCESASPCPKQSPRVAKTQQKRRNRSSAED 304
gi 965910148 225 KASETHQGLPALKLEK-GHqAWPxE----QQKPHPRVRLQTGLLSRSLVCGCESAFPSPKQSPRGAGAPQKLRKRSPAGD 299
gi 584075901 226 QAAESHWGLSVPKLEH-VHqTQP-EDTGGQHKPHPGAWLQTGLQSGSAVWSCESAAPGPKQSPRGAPAQQKRRPRGAAQG 303
gi 831222849 227 KAAESHWGLPVQKLEN-VNqPQP-EDTSSQHRLHPGEWLKTGLVSRSLVWSRESASPGPKQSPRAARTQQKRRDCGSVGD 304
gi 313661452 234 NTAESNLEFPVLELENnVNqRQP-EDASSQQKPHFVEQLKSRLLSKNSPCSYESALLGPKQNQKTTETQAQQKSCSSEEK 312
gi 823457730 204 NTAESSLGLPVLEQRNdVNqRQP-EDVRSQQKPHSLEWSEVSLLSEGPPCSSESALLAPKQSQRVTKTQAQLETCGSEEK 282
gi 514473577 226 KAVESHQRLPVQKLEN-VNqTPP-EDSSSQQKPHPGERLKARILSRSAVYSCESASPGPKQSPQAAKTQQKRRNCGSAED 303
gi 655722749 224 KAAERHWGLPVQKLEN-VPqSQP-EDTSSQQKPHPGELLKTGLRSRSPVCSCESAPPGPKQSPQAAKTQQKCRNCDSEDN 301
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81905608  302 CDHRRRV---------------SLGNEGLVPEDADRER------STAVRV--LPA----LELSDP---GLLLKQDLAKAK 351
gi 82188134  311 SEKGSRSvlqeiarqaniqsphSQEDQEFKSGQFQVAE------ECVEAC--LPVpisvSSIKSLvdvKALSSSKLSNNK 382
gi 847126327 322 -ERCKKS---------------CLTSDTFIQQGMQRNE------AQVKDLehVPL----ASQTDP---VRHVSADRGDTL 372
gi 114680935 305 FDHHRRV---------------SLGSDRLVPREIIVEK------SKAVRV--LPA----SELSDP---GLLLKQDLAKTT 354
gi 965910148 300 ADHHKRV---------------SLGSDRLALREIIVXK------RKaa--rvLPTg----ELSDP---GLLLKQDLAETA 349
gi 584075901 304 SDHCESV---------------SLGSDRFLPREMRAGT------SKAVRV--LPT----SELSDP---GLLLKEDLAKAM 353
gi 831222849 305 FDHRKRV---------------SLGSDQLVPREVIVEK------CKAVST--LPA----LELSDP---GLLLKQDLAKTT 354
gi 313661452 313 LDLFKEI---------------SSEEAPLIPSNTERSK------CSDDHL--GLF----LEEKTPlnsRLFSKQDLTEIA 365
gi 823457730 283 LEHFTKV---------------SSEGPPLTSINIEMSE------CDGNCL--GPF----LEEKKPlnsRLFSAQDMTKTV 335
gi 514473577 304 FDHHKRV---------------SLGSDQLVSGEIIVEK------SAAVSV--LPT----VELSDL---GLPLKQDLAKTI 353
gi 655722749 302 FDHHKRV---------------SLGNDRLVPXRNNSGDggvgwgKEAVNV--LPT----LELSDP---GFLLKQDLAKTM 357
                        410
                 ....*....|..
gi 81905608  352 AKEELHALENLS 363
gi 82188134  383 DVTESYLDTTGP 394
gi 847126327 373 PSKPAAIISVAS 384
gi 114680935 355 SKEELHVLESLS 366
gi 965910148 350 SNEELHVLEtls 361
gi 584075901 354 SNEELHVLENLS 365
gi 831222849 355 SKEELRVLENLS 366
gi 313661452 366 SDEELITFGKNL 377
gi 823457730 336 VDQKSLTLRKNP 347
gi 514473577 354 SKEELHVLENLS 365
gi 655722749 358 SKEDLNVLENLS 369
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap