Conserved Protein Domain Family
AP1AR

?
pfam15745: AP1AR 
AP-1 complex-associated regulatory protein
Statistics
?
PSSM-Id: 318042
View PSSM: pfam15745
Aligned: 5 rows
Threshold Bit Score: 429.739
Threshold Setting Gi: 672890262
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 597767331  22 GGGSKYFRSSTVGEHTTIEFENLVDSDEGESSQSCPRPISEEEIGHLKELRYGAITDKQTLIDEKLTAELVAQEEKLRLE 101
gi 74002372   26 GGGSKYFRTCSRGEHLTIEFENLVESDEGESPGSSHRPLTEEEIVNLRERHYDSIAEKQKDLDMKIQKELALQEEKLRLE 105
gi 224049154  24 GGGSKYFRTCSTGEHFTIEFENLVESDEGESPGSSHRPLTEEEIADLKERHYDSIAEKQRVVDLKLQTELALQEEKLRLE 103
gi 432880217  22 GGGSKYFRSSTTGEHYTIEFDNLVESDEAESPQPCPRPISEDELKNLQEHRYAAISDKQVLIDQKLQAELEAQEEKLRLE 101
gi 672890262  22 GGGSKYFRSNTAGEHFTIEFENLVESDEGESSQICPRPISEEEISHLKEHRYAALSDKQVQIDETLKAQLVAEEEKLRLE 101
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 597767331 102 EEAICAAQREAAKLAKERKLKEQLAQ----RSRARVEAEGSGt---HRKHRPSGGEFEVYLQSVKAQSEAFRSSRLSSET 174
gi 74002372  106 EEALYAAQREAARAAKQRKLLEQERQ----RVVQRYHPSNNG----EYQSAGPEDDFESCLRNIKSQYEVFRSSRLSSDA 177
gi 224049154 104 EEALYAAQRQAARAAKQKKLLEQRRQh---RITQRAHPVNNG----EFQSSVAEEDLDPFLRNTKFQYEAFRSSRLSSDA 176
gi 432880217 102 EEARNAAQREAARLARERKLKERKrgkadgassETQQKKFVGvhegTTEKQTSGENFDVYLQNVKAQSEAFRSNRLPSDT 181
gi 672890262 102 EEAVFAAQREAARLAKERKLKEGKPQ----RTKPRSEPESKDp---RHKSKASDEDFEVYLQSVKAQSEAFRSNRLSSET 174
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 597767331 175 NVVTPNTESSWDFTSKTRST--NDDATSLDLEWEDEEGMNRMGPAWERSKTEEDILRAALCPGGRQLGSGPPSASEDSNA 252
gi 74002372  178 TVLTPNTESSCDLMTKTKSTsgNDDSTSLDLEWEDEEGMNRMLPMRERSKTEEDILRAALKYSSKKTGSNPTSASDDSNG 257
gi 224049154 177 TVLTPNTESSCDLMTKTKSVsgNDDSTSLDLEWEDEEGMNRMIPVRERSKTEEDILRAALKFNSRKPGSHPASASDDSNG 256
gi 432880217 182 NTVTPNTEYSWDFTTKTRST--NEDGTSLDLEWEDEEGINRAFPAWERSRTEEDILRAALRPGSKPTHSGPTSASEDSNA 259
gi 672890262 175 NVVTPNTESSWDFTSKT-------DATSLELEWEDEEGMNRMGPAWERSKTEEDILRAALRPGGRQQDSGPTSTSEDSTA 247
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|
gi 597767331 253 LEWENDFVSAHAEDigdHGDEEFEGFVNPVLDTPSEETEVKPi-TDQQDR 301
gi 74002372  258 LEWENDFVSAEMDD---NGNSEYSGFVNPVLELSDSGIKQSD--TDQQKR 302
gi 224049154 257 LEWENDFVSAAVDD---NGNSEYAGFVNPVLELSASDVRLSD--SEHQDR 301
gi 432880217 260 LEWENDFVSSRPED---NPDVEFQGFVNPVLDTPSEAVSDCSlhSDVQDR 306
gi 672890262 248 LEWENDFVSAHPDDsgeHEDS--AGLVNPALDTPTEEAENQT--ADQQER 293
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap