Conserved Protein Domain Family
DUF4687

?
pfam15747: DUF4687 
Domain of unknown function (DUF4687)
This family of proteins is found in eukaryotes. Proteins in this family are typically between 76 and 140 amino acids in length.
Statistics
?
PSSM-Id: 318044
View PSSM: pfam15747
Aligned: 10 rows
Threshold Bit Score: 155.41
Threshold Setting Gi: 0
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122138701   1 MAQNSVSLSAGDRRSRVAYlSSSHGD--LSSSALALAMVSGDSFLVTRPEAILPEPVPRSSVRLNFRTESRRAPGGGRSP 78
2_pfamImport   1 MALNYVSLSAGDQANRVAY-RSSHGD--LRPSASALAMVSGDSFLVARPEATPPIPIPRQAGRPSVRPERSRAAAGGRSP 77
5_pfamImport   1 MALNCVSLSAGDQRNRAAY-RALPGD--RSPSASAWAMVSGDGFLVARPGAVRPG--PRQAVRPNIR-ESRRVTASGRSP 74
9_pfamImport   1 MALNNVSLSAGDQRTRRAY-RASLGA--LSSSALELAMVSGDSFLVARPDDVLPGLAPRQAVRPGVRTESRRASAGGRSP 77
7_pfamImport   1 MAQNNVPLSAGDQGNRGTY-RSSHGDpnLSPSASALAMVSGDSVLVARPETIH--LGPRPAVRPSVRIESRRVTGGGWSP 77
4_pfamImport   1 MALNNVSLSAGDQRSRVAY-RSSHGD--LRPRASALAMVSGDGFLVSRPEAIH--LGPRQAVRPSVRAESRRVNGGGRSP 75
3_pfamImport   1 MALNDVSLSAGDRGNTVAQ-RAPRGG--LSPPASALATVSGDSALVARPEATHPGPPLRQATQPGARPERRRATGSGWGS 77
8_pfamImport   1 MVLNYVSMSAGDQGNRVAY-RSARGD--LSPSALALVMVSGDSFLVTRPEAIHPGYTLRQAVRPSIRTENRRATGGAWGP 77
gi 118151186   1 MAQNSVSLSAGDRRSRVAYlSSSHGD--LSSSALALAMVSGDSFLVTRPEAILPEPVPRSSVRLNFRTESRRAPGGGRSP 78
gi 344293140   1 MALNCASLSAGDQGCRTAP-RAARGD--LGPSAVALAMVSGDSVFTARPGAIYAGPGPRQSVRPSVRTENRRLAAGGGGP 77
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|...
gi 122138701  79 TRFNEGREMEARSRSRQARFSPYPGPAVKLDLLRSVLQQRLVA 121
2_pfamImport  78 ARVIKGREPDGRNRSRQARFSPYPTPGVKLDLLRSVLQQRLVA 120
5_pfamImport  75 PSLINGRDPDARSRGHQTRFSPYPPRGVKLDLLRSVLQQRLVA 117
9_pfamImport  78 TRLIKGREPDGRNRSRQARFSPYPAPGVKLDLLRSLLQQRLVA 120
7_pfamImport  78 TRLKKGRELDSRNRSRQARFSPYPVPGVKLDLLRSVLQQRLVA 120
4_pfamImport  76 TRFINGREPDGRGRSRQARFSPYPIPAVEPDLLRSVLQQRLIA 118
3_pfamImport  78 PRSVKGRDPDGRRRCHAARFSPYPAPGAELDLLR--------- 111
8_pfamImport  78 TRFIKGRDLDGRDRSRQSRFSPYPTPGVKLDLLRSVLQQRLIA 120
gi 118151186  79 TRFNEGREMEARSRSRQARFSPYPGPAVKLDLLRSVLQQRLVA 121
gi 344293140  78 TRLIKGGASEGRRRGRRARVSPYPAPGVKLDPLRSVLQRHLVA 120
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap