Conserved Protein Domain Family
SPESP1

?
pfam15754: SPESP1 
Sperm equatorial segment protein 1
Statistics
?
PSSM-Id: 318050
View PSSM: pfam15754
Aligned: 10 rows
Threshold Bit Score: 467.779
Threshold Setting Gi: 125991191
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 125991191  21 PTATVLPDEEQNLNHYVQILQNLIMSVPTK-EQGFGRKFRSSRTVDGAEARSLSSEML-LTPGLVSAqevttpETEVMLT 98
gi 122138608  21 RRVTVTPDEEQNLNHYVQVLQNLILSVPTK-EPGRQKKSKSPNNANFIGPRVSRVKELkYTHDVGPG------DNDVLIN 93
gi 81175015   20 PTITVLPDEEQNLNHYVHILQNLIMSVPTK-EQDLGKKLSSSRTVDSAEPRSLASKVL-LTPGLVSAqdv-tpESDVLIR 96
gi 317373280  21 PSITVTPDEEQNLNHYIQVLENLVRSVPSG-EPGREKKSNSPKHVYSIASKGSKFKEL-VTHGDAST------ENDVLTN 92
gi 511877378  23 PSITVTPDEEQNLNHYVEVLQNLILSVPTR-EPGREKKSKSPNNVHSIGPKVSRLKEI-ITHGDVST------ENDVLIN 94
gi 512987779  68 RSLTVSPNEERNLNHYVQVLENLILRVPTK-EPDGEKKSVSPNHVYSPDLPVSRPKAL-STLRDALT------EN---TD 136
gi 351714322  24 RSLTVSPNEERNLNHYVQVLENLILRVPTK-EPDGEKKSVSPNHVYSPDLPVSRPKAL-STLRDALT------EN---TD 92
gi 344284413   7 gGITVTPDEEQNLNHYVQVLQNLLLSVPTKeEPGHKLKSKPPNNVYSTGSKVSKFKEI-ITHAEAVN------ENDVLIN 79
gi 345794740  10 tGITVTPDEEQNLNHYVEVLQNLILSVPTK-EPGHEKKLKSPNNVYSIGPKVSKLKEI-ITHGDSST------ENDVLIN 81
gi 671031914  23 PSITVTPDEEQNLNHYVEVLQNLILSVPTR-EPGREKKSKSPNNVHSIGPKVSRLKEI-ITHGDSST------ENDVLIN 94
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 125991191  99 SM-VEKTTFPSSGFTMESEKRR-THSKAFWSIQPNNVSIVLHTEEPYIEK-EPEPepeleteeesrrlatEPE------- 168
gi 122138608  94 PVsEETTTFPTRGFTLEIDKKKrTKSTAFWSIKPSNVSVVLHAKEPFIEKdEPEP---------------EPE------- 151
gi 81175015   97 PV-DETTNSRTRGFTL--RRRR-TQSTAFWSIRPNNISVVLRTEEPFIEK-EPEPeless------rlptEPE------- 158
gi 317373280  93 PIsEETTTFPTGGFTPEIGKKKhTESTPFWSIKPNNVSIVLHAEEPYIENeEPEP---------------EPEpaakqte 157
gi 511877378  95 PLgEETTASPTGGFTLEVQKKKpTESTAFWSIKPNNVSIVLHSDEPYIVK-EPEP---------------EPE------- 151
gi 512987779 137 PTnGHSTAFPATGPTQGPESKKpTESMAFWSIRPNNVSIVLHTEEPYIEK-EPEP---------------EPV------- 193
gi 351714322  93 PTnGHSTAFPATGPTQGPESKKpTESMAFWSIRPNNVSIVLHTEEPYIEK-EPEP---------------EPVmkh---- 152
gi 344284413  80 PIsEETTAFPTSGFTLEIERKKrTKSTAFWRIKPNNVSVVLHAKEPYIEDeEPEV---------------DTK------- 137
gi 345794740  82 AAgEETTASPTGGFTLEVSKRKpTEVTAFWSIKPNNVSVVLRTDEPYIIK-EPEP---------------EPEtkp--te 143
gi 671031914  95 PVgEETTASPTGGFTLEVEKKKpTETTAFWSIKPNNVSVVLHTDEPYVVK-EPEP---------------EPE------- 151
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 125991191 169 -PEPESE--------SAPE---TEtrqtaeseeevetstaqnkvrtgtsrmSTVITQTTNTQGTPNTVTVKTINNLDVST 236
gi 122138608 152 -PEPEPE--------PVEH---RT---------------------------GAPTQVPSVTEPSQDVTSLSGSTDLGTAT 192
gi 81175015  159 -PELEPE--------PEPV---AEsrqmsepeeelvtsttpnkeltgtsriSSMATQPANTQATRITVTVKTTSTMDVST 226
gi 317373280 158 aPRMLPV--------V-----------------------------------TESSTSPYVTSYKSPVTTLDKSTGIGIST 194
gi 511877378 152 -PEPEPE--------IsqT---NPwl-----------------------nfTETSPSPEVTSGQPSVTPLSIYTDMNTVT 196
gi 512987779 194 -MKHTEA--------P------------------------------------RSSPFTTRSSTSPPVITTPSSTDLEMST 228
gi 351714322 153 ------------------------------------------------teaSRSSPFTTRSSTSPPVITTPSSTDLEMST 184
gi 344284413 138 -P----------------T---RTsktf--------------------srvTDFPRRSAFTTRMPPIATTKESTDFGEPT 177
gi 345794740 144 gPKPLPT--------I-----------------------------------TKDYISPDATSAHPSVTSLNRYTDMDTIT 180
gi 671031914 152 -PEPEPEpepepepeLAQTeapHPwp-----------------------nvTETPPSPDITSGPPPITSSSRSTDMDTVT 207
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 125991191 237 ESEDVPQLSGQSEILNVEdlp-ghhSLSTRHENILRKISNINSQIHQGLLSDHSSPAYKEFIKASREHLKRSLALAAAAE 315
gi 122138608 193 EEEDVPQLSGDNEMDYLE-------SHDMYNEDVLKRIADINSQLHHVPLPESYKPEYRADIRASKEHLKRSLALAIAAE 265
gi 81175015  227 DSEDVPQLSGQSEIPSAEdlp-grhSLNTRHEDILKKISNINAEIQQGLLGGNNSPEFKEFIKASREHLKRSLALAAAAE 305
gi 317373280 195 ESEDVPQLSGETAIEKPEefg--khPESWNNDDILKKILDINSQVQQALLSDTSNPAYREDIEASKDHLKRSLALAAAAE 272
gi 511877378 197 ELEDVPQLSGEYEMGTPDtvtfgkhPQILNNEDILKKISDIHSQVQRVPLAESLKPEYREDIRASREHLKRSLALAEAAE 276
gi 512987779 229 ESEDVPQLWGENLEESTEh-----hSQAMNNDDILRKISCIHSQLQQPSLNDKNDPEYKVEIEAFMENLKGSLALATAAE 303
gi 351714322 185 ESEDVPQLWGENLEESTEh-----hSQAMNNDDILRKISCIHSQLQQPSLNDKNDPEYKVEIEAFMENLKGSLALATAAE 259
gi 344284413 178 EPEDVPQLSGAFDEEKLEastfvkqPQGLNNDDILKKISDIHSQVQQAPLRDDLNKESREDIQASKDHLRRSIALAAAAE 257
gi 345794740 181 EPEDVPQLSGEYEVDKPElqtfvrqPQLLSNDDILKKISDIKSQVQQVPLAESLKPEYREDIRASREHLKRSLALAEAAE 260
gi 671031914 208 ELEDVPQLSGEYEMEKPDaltfekhPQILNNEDILKKISDIHSQVQQVPLAESLKPEYREDIRASREHLKRSLALAEAAE 287
                        330       340       350       360       370       380
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 125991191 316 HKLQQMYGSNVFLDGHTSDPDDDMEVIINMLYNSRSKLSDYFTINHVPSELREKATVVIAVLKKIL 381
gi 122138608 266 HKLEKMYKSQMLPQGRSSGGVYDIITVINMLYNSRYKLSEYLDIKYVPLEMRGKATVVVHTLKRIL 331
gi 81175015  306 HKLEQMYGSNVFPEGRTSDPDNDMEMIINMLYNSRSKLSDYFNIKRVPSELREKASVVNAELRKIL 371
gi 317373280 273 HKLKTMYKSQLLPVGRTSNKIDDIETVINMLCNSRSKLYEYLDIKCVPPEMREKAATVFNTLKNMC 338
gi 511877378 277 HKLQKMYRSQLLPLARSSSGIDDIETVINTLYNSRSKLAKYLDIRYVPPEMRQKATTVFSTLKKIL 342
gi 512987779 304 HRLEKMYKSHVFSEGQTSERTYDIETVINMLYNSRCKLSKYLDIKYVPPEMREKATTVFNTLKNIL 369
gi 351714322 260 HRLEKMYKSHVFSEGQTSERTYDIETVINMLYNSRCKLSKYLDIKYVPPEMREKATTVFNTLKNIL 325
gi 344284413 258 HKLTKMYESQILPLGQTGDEVGNLETVINMLYNSRSKLSEYFDIKYVPPEMREKASTVFATLKEVL 323
gi 345794740 261 HKLQKMYRSQLLPVGQSSSGIEDIESFINMLYNSRSKLPEYLDIRYVPPEMRGKATTIYNALRKIL 326
gi 671031914 288 HKLQKMYRSQLLPLGRSSSGIDDSETVINMLYNSRSKLSEYLDVRSVPPEMRQKATTVLSTLKKIL 353
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap