Conserved Protein Domain Family
Amelotin

?
pfam15757: Amelotin 
Amelotin
This ameloblast-specific family of proteins may play a role in dental enamel formation.
Statistics
?
PSSM-Id: 318053
View PSSM: pfam15757
Aligned: 15 rows
Threshold Bit Score: 217.027
Threshold Setting Gi: 821490198
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 55976766    20 QLNPASGVPATKPTPGQVTPLPQQQPNQVFPSISLIPLTQLLTLGSDLPLFN-PAAG-PHGAHTLPFTLGPLNGQQQLQP 97
gi 431900084   55 QLNPALRLPPTKLVPDQATLLNQQQPNQVFPSLGVIPLTQMLTLGSDLQLLN-PAAGmAPAAQTLPLTLVALNVQQQLQP 133
gi 558150669   20 QLKPALGLPPTQLVPDQTTLLNRQQPHQVFPSLSLIPLTQMLTMVSDLQLLNpPPAGmAPAAHTLPLALGGLNVQQQLQP 99
gi 927168139   20 QFNPVLGLPPTKLVPDQATLRNQQQPNQVFPSLSLIPLTQMLTLGSDLQLLN-PAIGmVPSSQTLPLTLGALNVQQQLQP 98
gi 73975369    20 QLNPALGLPPTKLTPHQATLLNQQQPNQVFPSLSLIPLTQMFTLASDLQLLN-PAAGmASGTQTLPLSLGVLNTQQQLQP 98
gi 440904995   20 QLNPALVLPPTKLVPDQATLLNPQQPNQVFSSLSLIPLTHMLTLGSNLQLLN-PAAGmPSGTQTLPLALGGLKVQQQLQP 98
gi 351705126   20 QLNSALEVSPTKLAPDQVTPLTQQQPSQVFPSLNLIPLTQLLTLGSDLRLLT-PAPGlAPGAQKLPLTLGALNGQNQQQP 98
gi 914918033   20 QFN--LGLAPTKPAPDQASQLNQQQPNQVFSSLSLIPLTQLLTLGADLQLFN-PAIGmAPGAQTLPLTLGALNGQQQLQS 96
gi 1040185614  19 QLNPALELPPTKQAPDQETPLNQQQPTQVFPSLSLIPLTQMLTL------LN-PAAGmAPGAQTLPLTLEKLDGQQQLQP 91
gi 831244677   19 HLSPTLGLQPTKLAPDEATLPTQQQPNQVLPSISLIPLTQMLTLGSDLRLLS-PAAGlAPGAQAHSPSLGGLNAQ-QLQP 96
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 55976766    98 QMLPIIVAQLGAQGALLSSEELPLASQIFTGLLIHPLFPGAIPPSGQAGTKPDVQNGVLPTRQAGAKAVNQGTTPGHVTT 177
gi 431900084  134 QMLPVIVAQLGAQGTILSSEELPVAPQIFAGLIFQPLLSGAILPTSQ--ANPDVQNGILPAGQAGINPPIRRAPGSPFPT 211
gi 558150669  100 QMLPLIVAQLGAQGTILSSEELPVAPQIFTGLLFHPLFSGAILPTSH--ANPDIQNTILPAGQAGVNPAVQGAPEGPSPT 177
gi 927168139   99 QMIPVIVAHLGAQGAILSSEELPATRQILTGLIFHTLFPGAILPPSP--AKPDAQNGIHPAGQAGANPAVQGTPRGPFPT 176
gi 73975369    99 QMLPVIVAHLGAHGAILSSEELPGSPQIFTGLIFQPLFPGAILPTSP--ANPDAQNGILPAGQAGGNPAIQGTPESFSTT 176
gi 440904995   99 QMLPVIVAHFGAQGTILSSEELQGTSQILTGLIFHPLFPGAILPTSQ--ANPDAQNGILPAGQAGANPAAQGTPEDPFST 176
gi 351705126   99 QMLPIFVAQIGAQ---------PLGSQIFTGLLLHPLFPGSILPTSQSGANLDAQNGALPGGQAGENANIQATPEGHLLT 169
gi 914918033   97 QMLPIIVAQLGAQGTILSSEELPLAPQIFTGLLIHPLFPGGIQPTNQAGANPDAQDGVLPAGQTGVNPTNQGTPASHLAT 176
gi 1040185614  92 QILPIIVAQLGTQGTILSSEEVPAAPHIFTGLLLHPLF------TSQTAANADSQDEVLPTGQAGVNPAIRATPA----- 160
gi 831244677   97 QMLPIFVAQLGAQGTILSSEELPVAPQIFTGLIIHPLFPGGVLPASQARANPDVQGGNLPAG----------TPEGHLTT 166
                         170       180       190
                  ....*....|....*....|....*....|...
gi 55976766   178 PGVTDDDdYEMSTPAGLRRATHTTEGTTIDPPN 210
gi 431900084  212 PSGAGND-FGVTTPAGIQRGMLTTEETTTGSPS 243
gi 558150669  178 PSGTDDD-FEVTTPAGIQRGMHIAEETTTGFPH 209
gi 927168139  177 SSGTDDD-FDVTTPAGLQRGTHATEETTTGSPN 208
gi 73975369   177 PSDTDDD-FGVTAPAGIQRGTHTTQETTSGPPN 208
gi 440904995  177 PSGTDDD-FASTTPAGIQRGRPTTEETPTGSPK 208
gi 351705126  170 PGVTDDD-FEATTPAGIQRATHTTKGITTGSPN 201
gi 914918033  177 PTGIDDDeFGETTPAGIRRGTQTTDETTTESPN 209
gi 1040185614 161 ----DDD-IGVTTPAGIQRSTPVTEETTSESPK 188
gi 831244677  167 PR--DDDeSGVTPPAGIRRGTSTAQDTTTELPN 197
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap