Conserved Protein Domain Family
DUF4692

?
pfam15763: DUF4692 
Domain of unknown function (DUF4692)
This family of proteins is found in eukaryotes. Proteins in this family are approximately 170 amino acids in length.
Statistics
?
PSSM-Id: 318058
View PSSM: pfam15763
Aligned: 16 rows
Threshold Bit Score: 143.807
Threshold Setting Gi: 821480227
Created: 30-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 351710946   2 ELWHGLVMAAVSLLLQACLLIVTGFLLSRHIARQSERMLKEVRLEARGSRSVHQPPPAAKETTETWIERSTRVSVPRYGR 81
gi 586536058   7 KLWHGLVIAVASLILQACLLVVVNYLLSRHIAKENEQLLQRARLQAPKLNPAHHHLPAAQEMKETRAERSTPVSEPCYRH 86
gi 558152743   7 QLWHGLVIAFVSLVLQACLLVAIYYLLSRHMAKENEQLLRRSRLWAPRPSPAHHHSPAAQETKETGAERSTPARESRYRN 86
gi 545215349   7 KLWHGLVIAGVSLILQSCLLAAITCLLGRHMANKNERNLKRARHQGPRPSPTHQHPPAAKGMKGTRVERSTPASEPRHRH 86
gi 332247695   7 EVWHGLVIAVVSLFLQACFLTAINYLLSRHMVHQSEQILKAARLQVPRPSPAHHHPPAVKEMKETQTERDIPISDPLYRH 86
gi 675749261  13 ELWHGLVIAAVSLFLQACLLIAFSCLLSRHMAHQSEQILKATRLQVPRPSPVCHHPPAAKEM-ETQTEMDALMSDPCFRH 91
gi 884929261   8 QLWHGLVIAVVSLILQACLLTVAGYVFSRRIGHQNERVLQVVRMKAQESGPSPQPPLAAKETAEAWTERSTPLCAPRYRR 87
gi 532087763   7 KLWHGLVIAVLSLFLQICLLMALNYLLSRNIAHQSERILKEARLQVREPSSAPHPFPVAKETWKE--------SAPQYRh 78
gi 742179672   7 EVWHGVVIAVVSLILQTCLLAVINYLLSRHMAKEIERILKGARSQAPSLCPTHCCPPAAEERKETRAERNVLVPEPRYRH 86
gi 335295294   7 KLWQGVVIAVVSLVLQACLLAAINYLLSRHMVKENERILKEARLQVPILSPAQPHAPAVKEIKEARAERNPPASEPRYRH 86
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 351710946  82 ESGTSLDSSegtDSSDGTDRAPP-TGQVINDVNYTQVVFSTPGGRSREPALDYENMKEATDYVNVNPQSHKHSFWAFSNP 160
gi 586536058  87 DSDTSSDSS---DTSDSSNSSPP-TGQATKNVNYTQVVFSATGRLKNKFALDYENIKETTDYVNIDPKSHTHNSWTFVNP 162
gi 558152743  87 NCHTSSESS---DTSDSAGHSPP-TGQATRNVNYTQVVFPATGRLENTSALDYEDIEDMTDYVNVDPKSHKHNFWTFVNP 162
gi 545215349  87 DSNPSSDSS---DSNDS---SPP-TRQDTKHVNYTQVTFSDPGGLENDSALDYENVKEATDYVNVNPKSHKPSLWTFVNP 159
gi 332247695  87 DSDTSSDSS---DSSCS---LPP-ACQATEDVDYTRVIFSAPGELKNDSALDYENIKEITDYVNVNPESHKPNFWYFVNP 159
gi 675749261  92 DSDTSLDSS---DGSCS---SPP-VCQATNHVDYTQVIFSAPGELKDDSALDYENIKEVTDYVNVKPKSHKPSFWNFVNP 164
gi 884929261  88 ESN---TLD---SSDSSDSSDSC---QITKDVNYTQVVFSTPGGLNRESSLDYENIKEATDYVNVNPKSDKPNFWAFSNP 158
gi 532087763  79 ESNTSSDSSissVSLNDPATLPS-TFQAIKDVNYTPVVFSAP-----ESVLDYENIKEATDYVNVNPEKPKPKIWTSVNA 152
gi 742179672  87 DSDTSSDSS---DSSNS---SPPtTSQVTKDVNYTQVVFAAPGDRRNDSVLDYENIKEATDYVNVNPKRQKPDFWTFVNP 160
gi 335295294  87 DSDTSSDSS---DSSDS---SPP-THQATKDVNYTQVIFSAPGGRRNESVLDYENIKETTDYVNVNPKTHKPNFWAFVNP 159
                        170
                 ....*....|...
gi 351710946 161 AVSEPVEYSQVVI 173
gi 586536058 163 AVSEPVEYTQVAI 175
gi 558152743 163 AASEPVEYSQVAM 175
gi 545215349 160 AVSEQVEYTQVAL 172
gi 332247695 160 ALSEPVEYDQVAM 172
gi 675749261 165 ALSEPVEYSQVAM 177
gi 884929261 159 AVSEPVEYTQVVI 171
gi 532087763 153 SFMDPVEYTQVAV 165
gi 742179672 161 AVSEPVEYTQVVM 173
gi 335295294 160 A-SEPVEYTQVAL 171
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap