Conserved Protein Domain Family
DUF4694

?
pfam15765: DUF4694 
Domain of unknown function (DUF4694)
This family of proteins is found in eukaryotes. Proteins in this family are typically between 154 and 217 amino acids in length. There is a conserved SSGY sequence motif.
Statistics
?
PSSM-Id: 318060
View PSSM: pfam15765
Aligned: 5 rows
Threshold Bit Score: 202.488
Threshold Setting Gi: 390471462
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 432112417  21 QPSFAEDRKGDSCDWNVQGQDVSLQPPYLECQPPLRPCHdTGATPEPLKVPGSNLGpawSSRSSDSSL-RSVRQGSLQKG 99
gi 390471462  71 PPIFLEGEKGESSVQNAQEGEPSLQSPSLAPRPPAWPRS-AGAAQEPRTVSGSNLS---ITQSRERHV-SSVQHPRPEDC 145
gi 224809592   8 PPTFLQGRNGESAAWNAQGQAPSLLPPSVESQPPTWPHHdTGATQKPLRVSGGSLR---NPWSSESGL-LSLQQSSLGKC 83
gi 224809584   8 PPTFLQGKQGESPSGEAQETGAGLQSASLEPQSPAWPRHdAEATQEPLRDSSGHLG---NTVSHESSVlSSLQHSSLEQC 84
gi 731506280  35 ASIFLQEGKGESPAWDAQGQDPNLQSPCLELQSHAWPCHnTGTPQDLLKSSCSDLR---GIRSSESDV-SSMRHLSPGKC 110
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 432112417 100 --GHISqRSSGYAGDEENSEVSLVGGKRTLQLSRRLGTQAIVTQTSQLCAAYRPDQLKSPAASPAPSAPQPGGE 171
gi 390471462 146 --SNGS-LSSGYAGDKEGSDISLVGSHRRVQLKRRLNTPTPSTQIGQLGSTDSLSCLKSRLTGPTHSTKQTGGQ 216
gi 224809592  84 sdSDISlLSSGYAGDEENSEVSLLGSTPILRLQRRLLTQAGSALTSQLCAVYSPSQIGNRLASQAHSVKQTGGE 157
gi 224809584  85 --IDISrLSSGYAGDEENSKVSLPGSHQIVRLSRRLHTQAGGAQNSQVCAVYSPKQLKRRLAHQAKGTKQTGRE 156
gi 731506280 111 --SSISlASSGYVGDKENSEVSLVGSGRVSRLSRGLSNQAGSTQTNHLCATYSSVQLKGRQTGQANSCKQTGGE 182
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap