Conserved Protein Domain Family
CC190

?
pfam15768: CC190 
Coiled-coil domain-containing protein 190
This family of proteins is found in eukaryotes. Proteins in this family are typically between 234 and 297 amino acids in length.
Statistics
?
PSSM-Id: 318063
View PSSM: pfam15768
Aligned: 17 rows
Threshold Bit Score: 305.509
Threshold Setting Gi: 611987320
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122134611   9 PLHKHFDLERKSAKQAEARLSQRLQRLEDICLYHVKSLTREQRQLQKELQRLQQ-DIIKKKLCSYFGN--RSQKRPEDVL 85
gi 884911259   9 PQHKHFDFERKNAKQAEVRLAHRLQKLEEVCLYHTKLVSREQRQLQKDLQRLQQ-DIVKKRFSSYLGH--ENQKNS-DVL 84
gi 655845639  12 aQDKHFDLERKSAKQAEARLSQRLRSLEEICLYHMKSLTREQRQLQKELQRLQQ-EIIKKKLSSYFGN--GIQKRPENIL 88
gi 914929524   9 SLHKHLDLERKIAKQAEARLRQRLQSLEDICLLHLKLLIREQRQLQREQQRLQQ-DIVKVRLSS-LGN--GTQKRPECVL 84
gi 821479695   9 DLSRQWETERKAAKRAEARLALGLLWLEECRLYRVNTVAKEQRQLQKELEKLRQaENSKKKFSSFSGVllGTQKKPE-MP 87
gi 332219374   9 QLYKHFDLERKNAKQAEARLDQRLQRLEDICLYHVKLLTWEQRQLQKELQRLQQaEAMKKKFSSYLGN--GIQKRPEdVL 86
gi 953852702  14 PLYKHFDWERKSAKQAEARLSQRLQRLEDICLYHMKLLTREQRQLQKELQRLQQaDIIKKKFSSYFGN--GIQQRPEdVL 91
gi 344286656   9 PMYKHFDLEKRTTKQAEARLSQSLQRLEDIRLYHLKLLTREQRQLQKDLQRLQQaDIIKKKFSSYFAN--GIQERPEdVL 86
gi 568911256   9 PLYKQFDLERKSARQAEARLSLRLQRLEIICLYHVKSLAREQRQLQKELQRLQQaDIIKKRFSSYVGH--EIQKRSKdVV 86
gi 157818511   9 PLYKQFDLERKGARQAEARLSLRLQRLEVICLYHVKSLAREQRQLQRELQRLQQ-DIVKKSFSSYVGR--EIQKRSEeVT 85
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122134611  86 TLSSQGGQKHRALQAN-KASALTTNTTQGRSKTKSQMPPFHHIGPKDPMKSKQQALSQNNRTSHFIEEKLQAQEKESI-- 162
gi 884911259  85 MFSLRGRQKHRLLESEcNIRALATRTIQETYKTKSPMPSVYCTGLKDPKKSKECQQSQSDNTYCFGEEKSQPQEKDSV-- 162
gi 655845639  89 KF-PQGKQKLRVPQTD-HVGPLATNTAPETYSSKPQRPPSHPTGLKDSMRNKEH-QCQNHRTACLAEEMPQAQGEDSI-- 163
gi 914929524  85 SFPPQQGQKHRPPKH--EVRALATNTTQEMYKIKSQMPPLCHTGLKNPTRRKENWRSPSHRTACFMAEKLPAQEKESV-- 160
gi 821479695  88 ILSQKRGQRHRIAEAG-VIR-IEAPLLQTKEYEASKPTDLPSSHAIDCIKNKE-AFSQSPRVPSCIGGGPKAPRSSSVtf 164
gi 332219374  87 MFSPQGGQKHRAPQAK-KMRSLATRMTQVTYKSKSQVPPSHDAGLKDPMKSKKQLLSQNNRTACFIKEQPQAQeKDSV-- 163
gi 953852702  92 VFSPHGEQKHRVPQAN-KVRALAASVTPKIYKTKSQMPPFHRTGLKDPRRSKEQLPSQNDKTPDFIEEKSQAQeNDSI-- 168
gi 344286656  87 MLSPQRGQKHRAPQPN-KFRALATSMPQEMYKTKSKMAPLHYIGLKDPMRSNEQSLSQNYRPTRFTEEKPQAQeKDFI-- 163
gi 568911256  87 TFLPPTGQRHAVPEP--KIRTLKNSVTQEV-KTKIPVPSLHDPVLKDTLRSQEHLLSHGERTSCFKEGSPQGQeGEPT-- 161
gi 157818511  86 TFSPQTGRRHTVLEP--KIRVLKTNITQEV-KNKIRVPSLHDPALKDAPRSQERLPSQNERTRRCKEGNSQARkGEAA-- 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122134611 163 -NPPKGKGSNESISLLCHNQDVSTHTVDGGPGSGPAGDSEPGHSDETRSNDASTRPDHNPAKQTPL----------DPVE 231
gi 884911259 163 -KTPKGKYPDSGTSALCQDQEVSTNTIEPDPDTSPPLESGMISEDATKSEGPSLKPGGNSGKQLLP----------NSTK 231
gi 655845639 164 -KAPKGRDPNKGISALCHHQAVSTSSSEKDPGSSPAGDSGAAPVDENRSQDANLKPGMNAGIQIPP----------HFTE 232
gi 914929524 161 -IPPQGIDPNKDTSVAHQDQMASSSTC----------GSGMVNLDEIRSKDASLKPWRNAVEQLPP----------HSVE 219
gi 821479695 165 tNPPQDQP--QGISVDLQKPG-AFSRAQTVPGA-PRGEGEVIEIMEI-NPDGGVGPKSGKHNENRRyipggemptfEGKT 239
gi 332219374 164 -NPPKDVDSSKGISVPCQNQEvSTNTIEQGPSSsPASDSGMACADEtrSKDVALKPDGNTGKQIPP----------NHME 232
gi 953852702 169 -NPPKGKDANTGISLLCQDQEvSTQTPDQGLSSsPAGDSGMAHVDEtrSKDADGNLDHDTGKQIPP----------NPME 237
gi 344286656 164 -NPPKGMDSSKGISILGQNQEnSTSILDQWSGSsPA--------DEtrSTYGNLQSDQDTQIEIPP----------NPMG 224
gi 568911256 162 -NPLKGVDPSKDVSVPCHDQElSTNKTEDSGVSsQDGERGSAPANEtrSENASQKPRGDADVQNSP----------SSVD 230
gi 157818511 161 -NPLKDTELSKDVSVPCHDQEvSTDKAEDSCMSsSDGERGSALADEirSENANRKPQGDAGVQNPP----------SSVD 229
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|....*..
gi 122134611 232 GG--GDFKDKPQTSTYLELFEKARKAHYLRHRVPPESERLLSIAEIF 276
gi 884911259 232 WA--VSFQDESTNSTFLELLDKVKNAHYLRHRIPPESERLLSIGEIF 276
gi 655845639 233 DA--R----ESTKQTFLELLAKVKNAHYLRHRVPPESERLLSIAEIF 273
gi 914929524 220 CV--GGCKGETTKPAFSELFAKVKNARYLRHRVLPQSERLLSIREIF 264
gi 821479695 240 CTfySYLRTVDTMPTYLELFAKVKNARYLRHRVPPESERVISIGEIF 286
gi 332219374 233 CA--GSFKGEFTKPTFLELLSKAGNAHYLRHRIPPESERLLSIGEIF 277
gi 953852702 238 CA--GNFKVKSTTSTYLELFAKVRNAHYLRHRVPPESERLLSLGEIF 282
gi 344286656 225 CSftGNVKAEATKSTYLELFAKARNARYLRHRVPPASERLLSIGEIF 271
gi 568911256 231 YA--GSFKDERTKPSFLELFEKAKNAHYVRHRVPPESERLLSIGEIF 275
gi 157818511 230 YA--GSVKEERTKPTFLELFEKAKKAHYLRHRVPPESERLLSIGEIF 274
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap