Conserved Protein Domain Family
DUF4698

?
pfam15769: DUF4698 
Domain of unknown function (DUF4698)
This family of proteins is found in eukaryotes. Proteins in this family are typically between 464 and 550 amino acids in length.
Statistics
?
PSSM-Id: 318064
View PSSM: pfam15769
Aligned: 14 rows
Threshold Bit Score: 565.955
Threshold Setting Gi: 556968946
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 296434427  59 LIQSVKIGRGYFAILREETAKKKKQQQLQKLKEEE--RNKFQPAEK------------IS-------E---IHYGDTLLS 114
gi 108935964  58 LIQCVKIGRGYFTMLQEETAFKKHQQHLKKLQEEE--LNKFQPAKK------------YS-------D---IQCRDTLLT 113
gi 612014718   1 -MRSVKMGQGYFDILKAETAMRKKVLLDKKKEEe--eRNKFQPAKI------------ATte---psD----------SS 52
gi 637343143 141 LINTVKRGRGYFYTLRKEDEERKNTLLMEQQKEEErlRTELQPPKP------------VSss---ssDedeIDRDLNEIF 205
gi 348584436  48 LVQYAKAGRGYFNFLKEESATKRKQQQLQKLKEEE--RNKFQPAKK------------LP-------E---IH-EDALLT 102
gi 733912583  20 HISIVKQGGEYFHILHQESLEQRKALK-AQKSQVArwRTDFQPCTY------------SSevevl-------deemnISS 79
gi 513210956 193 HINTVKQGGEYFHILHQESLEQKNALK-AQKSQTTiwRTDFQPCEY------------SSevevsdeE---MN----TSS 252
gi 556968946 155 LVSAVKQGRGYFQLLRKEEDSRRKEQLRAQREEAEkrRTECQPSQRssdeenseeeenAK--------------RFFKTE 220
gi 752404177  24 LLRSVKAGRGYLDMLREERALKEKQEQLQKLKEEE--RHKFQPAEK------------TS-------E---IHDGKTLLG 79
gi 946757410  42 LIRSVKIGRGYFAMLREESTLKKRQQQLQKLKEEE--EHKFQPAKK------------IS-------E---IQSRDTVLD 97
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 296434427 115 TYDD---EKLKTLGARVTRRPFTPIHSCIISPSLTEAHVEPLFRQLCALHWLLEALTIDHThHTMKPVITCWNPKDPGGS 191
gi 108935964 114 TYEY---EKMKKLEAGIIIRPFTPIHNCIMAPSLPESHVDPLFRQLCALHWLLEALTIDHThHTMRPVIACWNPKDPGGS 190
gi 612014718  53 LLLYsgvRKVEGMP-DMILRPFTPVYSCLVSSTMSESHIEPLFRQLCALHWLLEALTIDHNyHGMRPVITCWNEMDPGGI 131
gi 637343143 206 LTEFpfrRDTEKKKKKRFIQPFTPLHNGLLAKRHPNARYESMFRQLCVLNWLLEALTLEPT-YSMRPLITCWDAKDYGGG 284
gi 348584436 103 TYDE---EKPKKVEAG----PFIPIYNCILLPLLPKAHIEPLFRQLCALHWLLEALTIDHThHIMKPVITCFNTKDPGGS 175
gi 733912583  80 PIEGshpKKSGKKKKKITLWSYAPVYTSVLIPRPSEAQSECLFRQLCAIHWLLEALTLESS-SSMHSILSCWNLTDPGGF 158
gi 513210956 253 PIEGshpKKSGKKK-KMTLRSYTPVYTSVLIARPSEAQSECLFRQLCAIHWLLEALTLESS-SSMHSILSCWKLTDPGGF 330
gi 556968946 221 TPLQrsaRRSGKKKQAATARPFTPLHSSLISPSLSDTAMEPIFRQLCALNWLLEALTTEQG-AVLGPASSCWSLRDPGNS 299
gi 752404177  80 TYDD---EKVKKMGSG-LIHQIAPMHNSIISPSLPEAHVEPLFCQLCALHWLLEALTIDHThHTMNPVITCWNPKDPGGS 155
gi 946757410  98 TYDDekmKKA---EAELISRPFTPKYSCIISPLLPESHVEPLFRQLCALHWLLEALTIDHThHTMKPLITCWNTKDPGGS 174
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 296434427 192 KSTIKKINKDKSMGQKWEHFITAP----------------K--TKKF-KIP-TMRvt-nrKPSRRGSTLSLSRASGGSSP 250
gi 108935964 191 KSTIKKINKDKSMGQRWDHFVTAP----------------K--TKKF-KAP-AIRslatrKPSRRGSALSLTRTSGGSSP 250
gi 612014718 132 KNTLKKINKDKGITHRWDHFIMPP----------------K--TKKY-KMP-AARftttrKSSRKASTISLTRTSGGSSP 191
gi 637343143 285 KSTMKEINREKILQSRWEHFLTHN----------------T--AKRFgQRP-LFHsq-gkKVARKPVARSGSKMSGLSSP 344
gi 348584436 176 KSSIKKVNKDKSREQRWEHFITAS----------------K--TTKF-KLP-VIRnt-thKPSRRGSVLSLSRASGGSSP 234
gi 733912583 159 KKSVKEIEEEKFATYMWELFVMNT----------------KkyMRKArRIP-FRRqt-nkAAAPASSQLS-SQSSHGQTP 219
gi 513210956 331 KKSVKEIEEEKLTTYMWELFLTNT----------------KkyMRKArRIP-FRRqt-nkAAAPASSQLS-TQSSHGQTP 391
gi 556968946 300 RAALKRHLKEKTIDTRWEQFVTQSrskksgsrslqrqlllR--SRKL-SFLsVSR---------------LSTMSSAATP 361
gi 752404177 156 KSTIKKINKDKLVQQRWEQFVNAP----------------K--TKKS-KIP-VLRvs--hKPSRRGFTLGPSRTSGGSSQ 213
gi 946757410 175 KSTIKKVIKDKSMVQRWEHFLTAP----------------K--IKKF-KTP-TQRat-srKPSRRGSVLSLSRASAGSSP 233
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 296434427 251 QSSMI---SVNP-GSDEPpsvn--tqvtSSKDIEDNE---S---SS------TKPDEEPLYMNLQKLLEMVREDARRTV- 311
gi 108935964 251 QSSMM---SVNP-SSDEPt---------GSKDIEDNE---S---SS------TKPEEEVLHFSLQKLLEMVREDARRTI- 304
gi 612014718 192 QSSML---SVNPtGSDDPqssv--tvgtSSKELEDNE---S---SS------TKQDDESIPISLQKLMEMVREDARRTV- 253
gi 637343143 345 HSKTTltsSPTP-GSEEVahl----asdSARDVEDIE---ScysKQ------TKEEEEPMSYYLQTLIQIVHEDVAKNF- 409
gi 348584436 235 QSSMI---SVNP-GSDEPqsli--tqgtGSKDIEDNE---S---SS------TKPDEEPLHIYLQKLLEMVREDAHRTV- 295
gi 733912583 220 LSSVN---SLVLcSEDNVnlsgalasvtSV----------S---MQ------TKEQ-QFFP--------SPQKQMQRTHv 268
gi 513210956 392 LSSVS---SLVLcSEDNInlsgaladdtRA----------S---MQ------TKEQ-PFFPFP-QKQIQTTHVKASKDAr 447
gi 556968946 362 TLGSTs--SLAP-GLEELpmgsslldleAAGESEEWEsiaS---GSlyqskpNKEEEKPISDYLQKLLETVHQSISKEMe 435
gi 752404177 214 QSSMV---STNP-GSDEPagvi--tqgtGSKKTEDNE---S---PL------TKPDEEPLHINLQKLLEMVREDARRTV- 274
gi 946757410 234 LSSMI---SVNP-GSDEPpsvt--vqaaGNKDIEDTE---S---SS------TRPDED-LHINLQKLLEMVREEARRTI- 293
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 296434427 312 TIENGMQRkapsil-svlkqnKSNSAYKEMQTTLK------SSERSSSTSAESHIQPVQKk--------SKNRTNCDIn- 375
gi 108935964 305 LMETEMQKkapsil-slvkqvKSDYGWKDWQTTHK------SSERSSTTSGESHIQVTQKk--------SKGRANRDI-- 367
gi 612014718 254 LTEDDSYKkitstvsilkpsfRSDTNLKETTQKSS------ITDKSSSTSTESLRRPRSNp--------SGSL------- 312
gi 637343143 410 SKANLLFNikrpys--htvstRSEPGSEVFVGTRVkssassSRDDRGSPGAMREGTPAEQr--------LKGSf------ 473
gi 348584436 296 IMESEMQRkppsl---lsvvhKSESIIKEGQATHK------SSEKSSTTSGESHTQTVQKk--------TKSYAHRDI-- 356
gi 733912583 269 KASKDVHEqadml------------------------------------------------------ttglqSCHISHf- 293
gi 513210956 448 EQEDMLKKtgl------------------------------------------------------------qsCRISQf- 466
gi 556968946 436 MADGEKSSs------------------sKSCPALG------QS---------PGGPST-WtkdslekqvSMDGQTPRPks 481
gi 752404177 275 MMENGMQRkapsil-pmlrqtKRDSACKDTQTTRK------SSDRFISTNGESHTQVIQKk--------SKSRTNRDI-- 337
gi 946757410 294 MMDSEVQKtapsis-smlkqtKSDSAYKDMQITLK------SSDRSSSTSGETHSQPIQKk--------SKSRTYHDL-- 356
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 296434427 376 ------------IHYKSGVCNTMRAKFYSVAQEAGFCLQDKMEILMKRQEERGIQKFRAFVLVSNFQKDIAKMRHHISVV 443
gi 108935964 368 ------------IYCKTGICNTMRAKFYSVAQEAGFCLQDKMEILKKRQEERGLQKFHSFIVTSNFQKDIAKMRHQVSMV 435
gi 612014718 313 -------------DTKNNVCATMRAKFFSIAQEAGFCLQDRLEILTKRQEERGIQKFLSFGVATNFYKDVEKMRHPLAIT 379
gi 637343143 474 ------------IRKKEELCNEMKKHFFEVAQECAFRLHDQLDILERRREERSIQKYMCLGRLKKFRKDVERMRQATVGK 541
gi 348584436 357 ------------AQYKSGLCSLMRAKFYSIAQEAGFCLQDKMEILMKRQEERSLQKFHAFTLVSNFKKDIAKMRQHVAAV 424
gi 733912583 294 ------------IKSKSNLCAETRHQFMAIREEAACCLHDALESLERSQEERCCKKYLALKQLKYFKKDMERIRQLDVRV 361
gi 513210956 467 ------------IKSKSNLCADARHQFMAIREEAAHRLHDALESLERTQEERCCQKYLALKRLKYFKEDMERIRQLDVRA 534
gi 556968946 482 sphrclsetshfIASKSYLSDTMRTKFCEVTEDAALCLHDSLETLERKRQENSTHKFQSLEHVTQFHRDVEKMRKTIRSL 561
gi 752404177 338 ------------IHSKTDVCSSMRAKFYSVAQEAGFCLQDKLEIFRKRQEERAHRMLQSFVITSNFKKDIAKMRHEATMV 405
gi 946757410 357 ------------IHCTTSVCTTMRAKFYNVAQEAGFCLQDKIEILMKRQEERGLQKFHSFVLVSNFQKDIAKMRHKVSMV 424
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 296434427 444 KGDAE-EIADHW--YFDLLSKLPEDLKNFRPAKKILVKLQKFGENLDLRIRPHVLLKVLQDLRIWELCSPDIAVAIEFVR 520
gi 108935964 436 KGDAE-EMADHW--YFDLLSKLPEDLKSFRPAKKILTKLQKFGENLDLRIRPHVLLKVLQDLRIWELCSPDIAVAIEFVR 512
gi 612014718 380 RGDAE-EIANHW--YFDLLSKLPEDLKRYRPAKKILQKLQKHGENLDLRIRPHVLLKVLQDLRSWELCSPDIAVAIEFVR 456
gi 637343143 542 EPVQD-AEAENW--FSTLLAKIPADAREDHRTQKILRKLQRFARNPDLRIRPITFLKVLGGLRIWEICSPDVSSAVQFLR 618
gi 348584436 425 RGDAD-EIADHW--YFDLLSKLPEDLKNYRPAKKILIKLQKFGENLDLRVRPHVLLKVLQDLRVWELCSPDVAVAIEFVR 501
gi 733912583 362 EREHD-ENGPKW--FPALLARLPEPVKNDHYVKKILKKLEKFGMAPDLHIDQDTFLKAVTDLQLWELCSPDVAAAVEFVR 438
gi 513210956 535 EREHD-ENGPKW--FPALLARLPEPVKNDCYVKKILKKLEKFGLAPDLHIDQDTLLKAAADLQLWELCCPDIAAAVEFVR 611
gi 556968946 562 EATQQkEKKSEEawFSSLLSALPSSVKDNINIQQVLKRLARFGERPNLRIRAHHFLKVLGGLRTWELCSPDISVAIEIVR 641
gi 752404177 406 KGDAE-EIANHW--YFQLLSKLPEDLKNFRPAQKVLAKLQKFGENLDLRIRPHVLLKVLQDLRTWELCCPDIAVAIEFVR 482
gi 946757410 425 KGDAE-EIADHW--YFDLLSKLPEDLKNFRPAKKILAKLQKFGENLDLRIRPHVLLKVLQDLRTWELCSPDVAVAIEFVR 501
                        570
                 ....*....|....*....
gi 296434427 521 EHIIHMPQEDYISWLQSRI 539
gi 108935964 513 EHIIHMPQEDYVNWLQSRV 531
gi 612014718 457 EHIVQMPQVDYIRWLRTRV 475
gi 637343143 619 EYVIQMPAEDFKKWLRSRV 637
gi 348584436 502 EHIIHMPREDYVTWLQSRV 520
gi 733912583 439 ESIVQMPEEDFSEWFQARV 457
gi 513210956 612 ESIVQMPEEDFSEWFQerv 630
gi 556968946 642 EKIVQMSGEDYETWLRSRV 660
gi 752404177 483 EHIVHMPEEDYITWLQTRI 501
gi 946757410 502 EHIIHMPQEDYVNWLQNRI 520
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap