Conserved Protein Domain Family
DUF4699

?
pfam15770: DUF4699 
Domain of unknown function (DUF4699)
This family of proteins is found in eukaryotes. Proteins in this family are typically between 303 and 319 amino acids in length.
Statistics
?
PSSM-Id: 318065
View PSSM: pfam15770
Aligned: 25 rows
Threshold Bit Score: 251.533
Threshold Setting Gi: 327283141
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74728286    9 IQSYLFDPVQVPSPGYVNEVNSCKLDEDDTDKL-KGKWSSEVLVQKNDPQRQGSKKTESSSRTADpwepcWPHQGPLPQG 87
gi 565303247  25 fPSYIFHPQEVQTAAYVNEINLYKSNEEERGKFhCKQQNRDILGHRNEVHIVEMQVAANQCRFHHskdalWSNRIPALPE 104
gi 344255008   6 tPSYLFDPVQVPSPGFVNEVNNCKLDEDDTVRL-KGTQNSEAEVPRNALHGESLTNTENRDGTAG-----LPHQGSLPQE 79
gi 348571595   9 IQSYLFDAVQAPSPDYVSEVSSTKLDEDHTDNL-KSR-SSEVLVHKNALWGEGLRRTESRSREAGpqepcGPPQGSLPQG 86
gi 733886416  45 IQSYIFDPEELQSPGCTHEGNSYKQDEQRSNKF-KFKQNREIKEQKKELQKDELNRTGIKNRVNStgetlWNHRGDAFQD 123
gi 874500829   9 IQSYIFDPEEVQSPGCIHEAKSCKRDEQSSNKF-KFKHNSEIQDHKNELQKDELNGTEHKNRVNStqgtlGNHGGNASQE 87
gi 449501180   9 IQSYIFDPEEVQSSGCIHEVNSYKHNEQGSNKS-KFKDKSENEEPKNELQGHEVNKTENKNPVSSiteslWNHRGNDSQE 87
gi 524995260   9 IQSYIIDPEEVQSSGCIHEVNSYKHKEQGSNKS-KFKENCENEDPKNELQKDEVNKTENKNPVNStteslWNHRGNDSHE 87
gi 612032054   9 IQSYFFDPVHAPPAGYINEVNNYKLEEEDGIKV-KGKENNEILVQKNDLQNEELKRTETKNRLNStqepfWHHRGPPPPE 87
gi 971395333  45 IQSYIFDPEELQSPGCTHEGNSYKQDEQRSNKF-KFKQNCEIKEQKKEIQKDELKGTGMKNRVNStgetlWNHRGDAFQD 123
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74728286   88 DAGGEhHAc----GVNGIGPA-ATPQPT--------GNSSPTQDDRGSWAS-----TAN-TVP----------------- 131
gi 565303247 105 KGLGNsVVk---cSMNGIHSSkDLSAPH--------HKTQPKEVNLHSSSG-----Q-Q-PEP----------------- 149
gi 344255008  80 DSEERhCVek-hgIVNGISPT-ATLHLV--------RSPRPHQVDSVSWASspwegTID-STH----------------- 131
gi 348571595  87 YPGEGlCTkp-ggTANGIGPS-ASPESS--------RNLWPHPGPMGSWAS-----TAD-SLH----------------- 133
gi 733886416 124 DSLVK-CVakldvAVNGSNSH-AGVHPT--------LSPSTN-------------------SVkeaseqgtssqpaepss 174
gi 874500829  88 DGLGR-CLakpdvAVNGGSSC-AGAHPG--------LGPNTNPVKEASEQGtsslqLAEpPSA----------------- 140
gi 449501180  88 DGLVK-CAakpdvAVNGGNSC-A-QHSM--------LNPNTSPVKETSEKEts--sQSEaSSA----------------- 137
gi 524995260  88 DGLVN-CAakldvAVNGGNSC-A-QHSM--------LNPNTNPVKETSEKGts--sQSEaSSA----------------- 137
gi 612032054  88 DDSGNsVAks-daPLNGISSS-PAVSPSvhaslsyrKEITPEESGSGSWAS-----ASS-EGD----------------- 142
gi 971395333 124 DSLVK-CVakhdvAVNGSNSH-AGVHPI--------LSPSTNSAKEASEQSts-sqPAEpSSV----------------- 175
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74728286  132 -PTQPFLEGGGTRKQDCVLLas--egTQVMRNGDSR-----APSEAes---------------faLEVQDH-VFQIPAPD 187
gi 565303247 150 -PAKRVFQPKTGDKLEIFDPennpkqTLETSNALCKeegsqMTTEPif---------------alPEMRDK-EVWLDNPS 212
gi 344255008 132 -PAQPFLEEEDCRKQSCMVPts--eeTQMVAHGDFK-----APAEV-------------------LAAADH-VLHIPAPD 183
gi 348571595 134 -SAQPFLEGRDTGSQDCVPPas--geTPAVGRGGCR-----APAEAes---------------pvSEGQAH-IPQLPVPD 189
gi 733886416 175 vNTGDFHSKLNECGQELDLG------AGRHRKADCN-----QTNSIlgvkpqsvedsnfpqgsavLEIQNNdAIRLPDID 243
gi 874500829 141 -STRDFHTHLN--GQELDIG------VGSHKKAACSepnsiqdgkaqa-----aehsaflrgtamLETKNT-TIQLPDID 205
gi 449501180 138 -SNRDLYTKSNrsgqeldle------tgsqskadsN-----VPNSIpdspsaehs--ifskgnsiLETENN-TITLPDID 202
gi 524995260 138 -SNRDFYTKSNRSWQELDLE------TSSRSKAASS-----VPNSIpdsqtaedt--vflkgnsiLETENN-AIRLPEID 202
gi 612032054 143 -PVEHFVKESDPGRKDPKPRap--eeTRVTSNGNSQasgenASSPGsh---------------htLEVQDH-LIPLPVPD 203
gi 971395333 176 -NTGDFHSKPNECGQELDLG------AGSHRKADCS-----QTNSIrgvkpwsiedsnflkgsavLETQNNdAIKLPDID 243
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74728286  188 YLQHWGPAgd---nVDHNEKDCVFKNHTEDESLEGiQPPVGEHGLNTPFSV--RrswDSLNEDVETEvlSICFNEKGPVH 262
gi 565303247 213 FLPEDNRAeksravGKENLPNHLVQINQSTENMTVvH------NWNLPCGE--SdegDSIW---RTSpfDLSFEDQIATE 281
gi 344255008 184 YPQLWNPTvd---nADPAEKDYLFENHPEVESLPGiHPRMSEQGLSLPFSL--KrswDSLNEAVTTEvlNVYFKEEGPTH 258
gi 348571595 190 YPQLWDPAgd---sEEQEEKDCLFETHAENEPLAEvHPGLTEYELNIPFPM--QrnwDSLNEAVATEvlSIYFNEKGPAQ 264
gi 733886416 244 YCQNGNQI------RNYVEKDSISVNCAHPDQMSK-HSVLQGQDLHVTSPLhmK---KSSIEPFNSD--SAGLSEDIPNS 311
gi 874500829 206 CHQNGNRL------RNYVEKDSFPVNCVHSDQVTR-PSATQVQGLCVTPPShaK---ESSIEPFKTD--SAGLSKDVLDG 273
gi 449501180 203 YPQNGNQT------GNYVEKDSFSVNCTHSDQNTG-ASAIQDQDARVIPPWpvK---ESSTEPFKTD--SASLSESFTAG 270
gi 524995260 203 YPQNGNQT------GNYVEKDSFSVNCAHSDQNTG-ASAIQDQDLHVIPPLpvK---ESSIESFKTD--SASLSESLTGG 270
gi 612032054 204 YPQVEVQAin--qiVD--ENDCFLSNHIMVEQMDRvDYASGDHLSNLCFSK--RrswDSFHEAIKTEalTMNFNED---- 273
gi 971395333 244 YCQNGNQI------RNYVEKDSISVNYTHPDQMNK-HLAMQGQDLHVTPPLqtK---ESSIEPFNTD--SAGLSEDIPNG 311
                        330       340       350       360       370
                 ....*....|....*....|....*....|....*....|....*....|...
gi 74728286  263 A-MPVVDSGNRQEDTHGSDGDGDGEIVDEDAAVAEALAALEAATAGEDLDETD 314
gi 565303247 282 IlSGRKKREPAWEARSDGLTKVNGELE-EDADIaealaaleaatageifeeee 333
gi 344255008 259 P-TSVVDSRNEQEVPHPYNGDRDG-VVDEDAEVAEALAALEAATAGEDADEAD 309
gi 348571595 265 V-VPIADSRSKQMPAQGSEGDSEEEEEDEDEAVAEALAALEAATAGEDEDEAD 316
gi 733886416 312 I-AATAVPTIAQAPTHNSHKDINGQIEEEDAEVAAALAALEAATAGEDLEEDD 363
gi 874500829 274 I-TAMAVSTALQAPPHPSHKDINGEIEEEDAEVAAALAALEAATAGEDLEDDD 325
gi 449501180 271 I-TAVAVTKVTQAHTHTNHKDVSGGFEEEDAEVAAALAALEAATAGEDMEDED 322
gi 524995260 271 I-TAVAVTKVAQAPTHTSHKGVNGGIEEEDAEVAAALAALDAATAGEDLEDDD 322
gi 612032054 274 --VSERDTDWGPE--------------QEDAAVAEALAALEAATAGEDGEEGD 310
gi 971395333 312 I-AAMAVPTAAQAPTHHSHRDINGQTEEEDAEVAAALAALEAATAGEDLEEDD 363
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap