Conserved Protein Domain Family
GREB1

?
pfam15782: GREB1 
Gene regulated by oestrogen in breast cancer
GREB1 (gene regulated by estrogen in breast cancer 1) was first identified as an oestrogen-regulated gene expressed in breast cancer. Its exact function is not known but its expression is regulated by the coordinated binding of oestrogen-receptors to distal sites interacting with Pol II to activate gene transcription from core promoters located at a considerable distance from the greb1 gene.
Statistics
?
PSSM-Id: 318077
View PSSM: pfam15782
Aligned: 8 rows
Threshold Bit Score: 3109.85
Threshold Setting Gi: 260829285
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 513178970    1 MGNSYAGQLKTTRFEEVLHNSIEASLRSNNLVPRPIFSQLYLEAEQQ---------------------LSS------LE- 52
gi 556977479    1 MGNSYAGQLKTTRFEEVLHNSIEASLRSNNLVPRPVFSQLYLEAEQQ---------------------LTS------VE- 52
gi 403265205    1 MGNSYAGQLKSARFEEALHNSIEASLRCNSVVPRPIFSQLYLDPDQHpf--------------------------ssADv 54
gi 733882421    1 MGNSYAGQLKSARFEEALHNSIEASLRCSSVVPRPIFSQLYLDPDQPpflpedvkpkveeldkelvhrFSQngnsdfST- 79
gi 260829285   57 MGNTH-GQLKSSRFEAALHSSIEQSLRSQDVAPRPVFSQLYLDKQQGhvrppgpenidvkpnikeleaAPRdrhssaSS- 134
gi 765115906    1 MGNSYAGQLRSARFEEVLHNSIEASLRSNTLVPRPVFSQLYLETEQS---------------------F----------- 48
gi 542244178    1 MGNSYAGQLRTTRFEEVLHNSIEASLRSNTIIPRPVFSQLYLETEQP---------------------LAR--------- 50
gi 768956703    1 MGNSYAGQMRTTRFEEVLHNSIEASLRSNVAVPPPVFSQLYLEIEKS---------------------LSFlcc------ 53
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 513178970   53 -------------------------AGS--------RADNEEEEEeeEEEGS-ESSSPVSYQMKPPPEGCCTTDGFCQAG 98
gi 556977479   53 -------------------------AGS--------RPENEEEEE--DDGSE-SNSPPIPYQMKPPPDGCCTTDGFCQAG 96
gi 403265205   55 kpkvedldkdlvhrytqngsldfsnSLT--------VNEMEDDEDd-EEMSD-SNSPPIPYSQKPAPEGSCTTDGFCQAG 124
gi 733882421   80 -------------------------NQT--------VNEMEDEEEd-EDMSD-SSSPPIPYSQKPAPEGSCTTDGFCQAG 124
gi 260829285  135 -------------------------TSGyrgnppaeQPSVDQSYEd-EEKEDpPGSPQQPYRFPTPPEGACQTPGYCQAG 188
gi 765115906   49 ---------------------------G--------RAENDDEDD--EDGSE-SNSPPIPYQMKPPPEGCCTADGFCQAG 90
gi 542244178   51 ----------------------------------------DDEDD--EDGSE-SNSPPIPYQMKPPPEGCCTTDGFCQAG 87
gi 768956703   54 -----------------------vsSKG--------HAEVDD-DD--EDASE-DTSPHIPYQMKPPPEGCCTTEGFCQAG 98
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 513178970   99 KDLRLVSISNEHIDVPSGFLLVGAKSPNLPDHLLVCAVDKRFLPDDNGRNALLGFSGNCVGCGKKGFCYFTEFSNHINLK 178
gi 556977479   97 KDLRLASISNEQIELPAGFLLVGAKSPNLLDHLLVCAVDKRFLPDDNGRNALLGFSGNCVGCGEKGFRYFTEFSNHINLK 176
gi 403265205  125 KDLRLVSLCMEQIDIPAGFLLVGAKSPNLPEHILVCAVDKRFLPDDNGKNALLGFSGNCIGCGERGFRYFTEFSNHINLK 204
gi 733882421  125 KDLRLVSLCTEQIDIPAGFLLVGAKSPNLPEHILVCAVDKRFLPDDHGKNALLGFSGNCIGCGERGFRYFTEFSNHINLK 204
gi 260829285  189 KDIRLTSLREVKLTLPEGFVLVGAKSPNLTNNILVAAVDARFLPNPKTNLALLGFSGNCIGCGEQGFRYFTEFSAHINMR 268
gi 765115906   91 KDLRLSSLASDTLDVPAGFMLVGVKSPSLPDNLLVCAVDHRFLPDERGRNALLGFSGNCMGCGEKGFRYFTEFSNHINLK 170
gi 542244178   88 RDLRLSSLASDPLDVPPGFMLVGVKSPSLPENLLVCAVDRRFLPDERGRYALLGFSGNCMGCGEKGFRYFTEFSNHINLK 167
gi 768956703   99 RDLRLSSLALDTFDVPPGFLLVGVKSHTLPEDLLVCTVDCRFLPDERGHDALLGFSGNCVGCGEKGFRYFTDFANHINLK 178
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 513178970  179 LTTQPKKQKHLKYYLVRNAQGALTKGSVICWKG--AELRGRQSSSSTCSGTVCQLPESAGLSGSTTSEPP---------- 246
gi 556977479  177 LTTQPKKQKHLKYYLVRNAQGVLTKGPLICWKG--TECRGQQSTSSTCSSAPSQPPESPSPLMMAATESVslvn------ 248
gi 403265205  205 LTTQPKKQKHLKYYLVRSSQGVLSKGPLICWK----ECRSRQSSASCQTIKPSSSVSSTVTPENGTANGYkagf------ 274
gi 733882421  205 LTTQPKKQKHLKYYLVRSSQGVLSKGPLICW----KECRSRQSSAASLSAKPNSAVSPSTTPEGGSANGYksgftqtdss 280
gi 260829285  269 LTTQPKKQKHLKYYIVRNNLGLLVRGPLVPWKVvsPEVRKRGFPMAPQVVSPLLSAAQGAQQATISYHANrvpa------ 342
gi 765115906  171 LSTQPKKQKHLKYHLYRNKQGILVKGAPICWRV--N------DGRIRPIRPTHSESTLTSHEQP----PNmalt------ 232
gi 542244178  168 LHTQPKKQKHLKYYLYRNSQGLLVKGAPICWRG--NDGRMRQLGPTLSEGQSTPDAQPPNLTL---SQPShtpg------ 236
gi 768956703  179 LSTQPKKQKHLKYLLYRNNQSVLVKGAPICWRG--HDtrt----kknGSSHVSSDEQPSNMPL---NHPShttg------ 243
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 513178970  247 --------------------------------------------PGTPQAATAIDH-IPSTAAFGSAAYNGKESPK-Q-- 278
gi 556977479  249 ----------------------------------------qnasAGSQQTGIPTDQaLPVLTSGTPTTLNGKDSPKhQ-- 286
gi 403265205  275 -------------------------------------------tqtdAANGN-------------SSHGGKGSASSsTpa 298
gi 733882421  281 vfspaksssainlsgtqdpsrnknvvkplalsvqlvgktfasaplslHATDGT-----------NGNTNGGRNNVLsS-- 347
gi 260829285      --------------------------------------------------------------------------------
gi 765115906  233 -----------------------------------------------yrtAVAGPHvDQQTTDLAHTLINGNHSAPsS-- 263
gi 542244178  237 --------------------------------------------------shsaSHaEPQTADVSHNLINDNQAVPsN-- 264
gi 768956703  244 ---------------------------------------------shtgGSHVDSAaGPQVNDAPQSITNCNLAVSsN-- 276
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 513178970  279 ---QLVK-NNLSALTRPSV-----------L----GTLTNSGPPKKRHKGWSPES-----PSSTETwnlPLNPQAP---N 331
gi 556977479  287 ---HSVKsSNLSMQMRPSV-----------I----GTLANSGPPKKRHKGWSPES-----PSATEAgglQSNQAVPfhgN 343
gi 403265205  299 hpgNY------SLSPRPSY-----------AsgdqATMFISGPPKKRHRGWYPGSp---lPQPGLVvpvPTVRPLSr-tE 357
gi 733882421  348 ---TVSRpMPHSTSPSPAC-----------AagdqASMSNSGPPKKRHRGWSPGSp---vPPPGLVvpvPTIRPSTr-tE 409
gi 260829285  343 -sllaAQqQHPSPQPRPSTikyggggspplPngpsPPDGSAQPPKKRHKGWGPGR-----PDT----------------- 399
gi 765115906  264 ---AQSS-LNQ--PGRSSA-----------P----ATHTNAGPPKKRHKGWSPDLsanslQESTVKsppASLSLSTlsvS 322
gi 542244178  265 ---THPP-LNQSGPGRPSA-----------T----GVHLNTGPPKKRHKGWSPESstsnlPESTAKtppSSLASSTlsvS 325
gi 768956703  277 ---VQLP-LNQSVARRPSV-----------T----APHSNSGPPKKRHKGWSPESaansvPDGTMKtptSSSSLPTlsvS 337
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 513178970  332 RIKn---------------dGGSL-SSLPHSALVGPASSpmvGSGEPVSVPDNLLKICKAKPVIFKGHGNFPYLCGNIND 395
gi 556977479  344 KAD-----------------GIGL-TCLSQPVPAGLLPSplaATGEPVSVPDNLLKISRTRPVILKGHGNFPYFCGNLND 405
gi 403265205  358 SPLs---------------aPVPQ-TPLTGILQPRPIPA-----GETVIVPENLLSNSGVRPVILIGYGTLPYFYGNVSD 416
gi 733882421  410 PLLs---------------vPVPQ-SMLTGILQPQPIPA-----GETVIVPENLLNNSGVRPVILIGYGTLPYFYGNVGD 468
gi 260829285  400 -----------------------M-SNLNLVMPPHPAMQ-----AESVFIQPGLLNICCTKPVVLACHGNLPYLHGNVND 450
gi 765115906  323 SVVtngnrseipslqsssqpSAAIf----------------pPLQLSVTVPDQLLHTCRLQPVILKGHGPLPQLTGNVRD 386
gi 542244178  326 SVAt---------------nGSRA-ETTAQQGSSQWISTplsPPEVPVIVPDQLLQTCRLQPVIFKGHGPLPQLTGSVSD 389
gi 768956703  338 SVIt---------------nGARSdGAAPGITStps------ppGLSVTVPDQLLHTCRLRPVIFTGHGTLPQLTGNVSE 396
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 513178970  396 VIVSPLLYTCYRNSQSLSRAYEQYGAPTIQPISEEMQLLLTVYYLVQLASDQVPLIEDLEQIFMRSWRESHLSEIRQYQQ 475
gi 556977479  406 IIVSPLLQTCYKNAQSLPRAYEQYGASPIQPLSVEMQILLTVYYLVQLAPDQAPLIEDLEQIFMRSWRESHLAEIRQYQQ 485
gi 403265205  417 IVVSPLLVNCYKIPQLENKDLEQLGLTGSQYLSVENMILLTIQYLVRLGPDQIPLREEFEQIMLKAMQEFTLRE--RALQ 494
gi 733882421  469 IVVSPLLVNCYKIPQLENKDLELLSLTSSQLLSVENMILLTIQYLVQLGPDQIPLREEFEQIMLKAMQEFTLRE--RSLQ 546
gi 260829285  451 VVVSTLLVDCYKPVQMPPKLLEGLGLTNAPPLSVETMALLTVQYLVQLGNEKVPLREEFDAILLQARQESAIKD--KNMQ 528
gi 765115906  387 ILVSSLLHSCYMSSQTLPRIYQHYGPSPIQPLSTEMQILLTIYYLVQLGPEQVPLVEDLEQIFMRSWRESHLSEIRQFQQ 466
gi 542244178  390 VLVSSLLQSCYLSSQTLPRVYQHYGPSPIQPLSTEMQILLTVYYLVQLGSDQVPLVEDLEQIFMRSWRESHLSEIRQYQQ 469
gi 768956703  397 VLVSSLLQSCYLSSQTLPRVYQHYGPSPIQPLSAEMQILLTVYYLVQLGPVQVPLIEDLEQILMRSWRESHLSEIRQYQQ 476
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 513178970  476 MIPQTFPQVP----S--------------------------QIAPVTSAQLPWLAGLAASSCNDSVHII-ECSYSLAEGL 524
gi 556977479  486 AHPQMLPQVR----V--------------------------QIPPVTSAQLPWLTRLAASSCNNSVHII-ESTNSLAEGL 534
gi 403265205  495 LGAQCVP--------------------------------------VSPGQLPWLARLIASVSQDLVHVI-VTQNSLAEGI 535
gi 733882421  547 MSAQCIS--------------------------------------VSPAQLPWLARLIASVSRDLVHVV-VTQNSLAEGI 587
gi 260829285  529 QHAQFLS--------------------------------------VAPAQLPWLAKVAASASNGLVRIV-NAQASLAEGI 569
gi 765115906  467 ------PQAP----Avqgrhytletpv--slpghlqqislqSQQTLTPSQLPWLAQLAASSSGEGVVVLgEDVRSLAQGL 534
gi 542244178  470 ------PQTT----GtpgrhygieippvlpglpqylslpsqSPQPLTPNQLPWLAQLAASSYGEGVVVLgKDVGSLAQGL 539
gi 768956703  477 ------PQPQhlpvPp------------------------qSQQPLSPSQLPWLAQLATSSCGEGVVVLgEHIKSLARGI 526
                         730       740       750       760       770       780       790       800
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 513178970  525 SEMFKLLIEGKLIKT--NYVVIICASRNRAIDSCIVITGKYQARVLSEGMLTPSDYQKEVNYQLVTGKVESLGSFFST-- 600
gi 556977479  535 SELFRSLAKGKLQQT--NFVVIIYSPKNRSTESCVAVIGKHQARALAESMFSPSESLKEINYELVTGKVASLGAFFST-- 610
gi 403265205  536 SETLRTLSEMRHYQRlpDYVVAICASKIRGNEFCVVVLGPHQSRALAESMLTTSEFLKEISYELITGKVSFLASHFKT-- 613
gi 733882421  588 SETLRTLNEMKHQQKlpDYVVAICASKIRGNEFCVVVLGQYQSRALAESMLTSSEFLKEISYELITGKVSFLASHFKN-- 665
gi 260829285  570 SETLQMICMPQPYTRypSFVLVIHVSRHRGTEFCVLVTGVHQARVVAESMLSASDCFKEISYEIITGKFNLLTSHFKEpn 649
gi 765115906  535 DQTFSRLIEGKLQNT--NYVVILVTTPGHETQSCVVVTGKHQCRALSESMFSPSEGLKEINLQLSSGVAEELIHFCKS-- 610
gi 542244178  540 QLTFSRLMEGRLENT--NYVVIIVTAPGQETQSCVVVTGKHQCRALAESMFSPSQGLKEIAHQLSTGVAQELIHYCNS-- 615
gi 768956703  527 QQTFNRLMEGQLENT--NYVVIIVSSPGEQTQSCVIVTGKHQCRALAESMYSPIEGLREISRQLSTDITQELLQYCHC-- 602
                         810       820       830       840       850       860       870       880
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 513178970  601 -LCP------------E------GDIDLLL----------------------------------EKFYQENQGHISSSLS 627
gi 556977479  611 -LCP------------D------GDINTLL----------------------------------DKFHQERSGKTSSPFS 637
gi 403265205  614 -TSL------------G------DDLDKLL----------------------------------EKMQQRRGDSVVIPFN 640
gi 733882421  666 -TSL------------G------DDLDKLL----------------------------------EKMLQQRGESVIIPFN 692
gi 260829285  650 tAMSvpvkkhaahipgN------SELDKLL----------------------------------DDFVGPMSGEVMVPYH 689
gi 765115906  611 -LGS------------D------GDIDKLLesnpansnealplsrnqecpeenmsspkkepnskDSQTQSSKDEV-SPKE 670
gi 542244178  616 -LGQ------------D------GDIDSLL----------------------------------DNAILDS-NEP-SPLS 640
gi 768956703  603 -LGD------------GvadmcyGDMDSLLdlaavdtkep---------------salsrnspkDSNIHISKDLP-SPKV 653
                         890       900       910       920       930       940       950       960
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 513178970  628 ASA-NKSTALNGTGAAV-------------------------CTS--YEIERHQIRPFQLAVAQKLLSHICSIADSSTQN 679
gi 556977479  638 ISFnKAVSSEGVATKATt-----------------------aCTS--YNTEWHQIRSIQLAVARKLLSHVCAIADSSTQN 692
gi 403265205  641 GDLnECVSPQEAAAMMP-------------------------TQNldLDSETFQIYQPQLTVARKLLSQVCAIADSGSQS 695
gi 733882421  693 GDVsECVSSQEAIAMVSt-----------------------qEPD--LDVDTFQIYQPQLTVARKLLSQVCAIADSGNQT 747
gi 260829285  690 GGElHRVREDVAKDMVPd-----------------------kQPD--VSTDHQELHPVQIAVAMKILSQVCAIADSGTQS 744
gi 765115906  671 SKHsCS--------------------------------------E--YSAEWREVRPIQLAVARKLLSHVCAIADSSTQN 710
gi 542244178  641 SSQeSAEERSNKSPRVThspkdphthlskdspkdtasstkdtCSE--YSVDWREVRPIQLAVARKLLSHVCAIADSSTQN 718
gi 768956703  654 QSAsLKDSCS--VSMSA---------------------------E--YLVEWCEVRPIQLAVARKLLSHVCAIADSSTQN 702
                         970       980       990      1000      1010      1020      1030      1040
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 513178970  680 LDLGSFEKIDFLICVPPSEVTYQQTLFHLWHSGILLELG-LEKQHLTKQKVEQYVLKLDA--EAQIKFKVFLQNSMQNPH 756
gi 556977479  693 LDLGSFEKVDFLIFVPPSEVTYQQIVLHLWQSGILLEIG-LEKKSVIKQRAEQYVVKMDA--EAQTKFKAFLQKSLQNPY 769
gi 403265205  696 LDLGHFSKVDFIIIVPRSEVLVQQTLQRIRQSGVLVDLG-LEENGTAHQRAEKYVVRLDN--EIQTKFEVFMRRVKQNPY 772
gi 733882421  748 LDLGHFSKVDFIVIVPRSEVLVQQTLQRIRQSGVLVDLG-LEDNGTAYQRAEKYVVRLDN--EIQTKFEVFMKRVKQNPY 824
gi 260829285  745 LDLGRFSKVDILVMVPPSNILYNQTVERLKQSGVLVDLG-METASSIDQKVDQYVMKCDSvaENQAKFESFVKHVRQHPY 823
gi 765115906  711 LDLGSFDRISFLILVPPSEVTFQQTVFHLRNSGVLQDLVsSDQECMSKLEPEQYVVKMDR--KAQARIDNLTQEAHRNPY 788
gi 542244178  719 LDLGSFDRVSFLILVPPSEVTFQQTILHLWSSGVLQELGsLDQACVSHREAERYVVKMDH--SAQARIDNLIREAYSNSY 796
gi 768956703  703 LDLGSFDRVSFLILVPPSEVTFQQTVLHLWSSGVL---GgLDQGCASKQEAERYVVKMDH--GAQARIESLIHEAHSNSY 777
                        1050      1060      1070      1080      1090      1100      1110      1120
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 513178970  757 TLFVLIHDHAHWDLMsa-mHSLYPQTELPTGLVDRLLNCREVKEAPNIVTLHVTSFPYALQTQHTHISPYNEIHWPSSYS 835
gi 556977479  770 TLFVLIHDHAHWDLVssgaPGPYPQTESYVGLIDRLLNCRQVTEAPNILILHVTSFPYALQTQQTRISPYNEIHWPSACN 849
gi 403265205  773 TLFVLVHDNSHVELTsv-iSGSLSHGEPSHGLADRVINCREVLEAFNLLVLQVSSFPYTLQTQQSRISSNNEVHWIQL-D 850
gi 733882421  825 TLFVLVHDNAHVDLTsa-iSSSLSHGEPSHGLADRVINCREVLEAFNLLVLQVSSFPYALQTQQSRISSSNEVHWIQF-D 902
gi 260829285  824 TLHVLIQDQAHVDVN--------RHSSGNMGLADKYINCKDFADAPNLLTLQVSASPFSLQTQKSRVTPHNEVFWPSNIK 895
gi 765115906  789 TLYILVHDHAHWDIS----SSSCSSPDSGLGLVDLLLNSQQVKDAANILILHVTSFPFALQTQCTRVSPYNEIHWPPAFS 864
gi 542244178  797 TLYILVHDHAHWDIS----SATYSSSDSGLGLVDQLLNSRQVKDATNILILHVTSFPFALQTQCTRISPYNEIHWPSAFS 872
gi 768956703  778 TLYILVHDHAHWDIH----NASCRSSDNGLGLVDQLLNSGLIRDAPNILILHVTSFPFALQTQCTRISPYNEIHWPSAFS 853
                        1130      1140      1150      1160      1170      1180      1190      1200
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 513178970  836 NGVDLYHENKKYFGLSEFIESTLSGHSIPLLRYDSSFEAMVMALGKRFPRLHSAVIRTFVLIQHYSAAMMAVCG----LS 911
gi 556977479  850 NGVDLYHENKKYFGLSEFIESTHTGHSLPLLRYDSSFEAMVMAVGERFPKLHSAVIRTYVLIQHYAAAMMAVSG----LS 925
gi 403265205  851 TGEDVGCEEKLYFGLNEYSKSLQWGVTSPLLRCDEAFEKMVNTLLERYPRLHSMVVRCYLLIQQYSEALMALTT----MA 926
gi 733882421  903 AVDDTASEDKLYFGLNEYSKSLQWGVTSPLLRCDETFEKMVTTLLERYPRLHSMVVRCYLLIQQYSQALMSLTT----MA 978
gi 260829285  896 QNPNVPPEDTVYFGVSDYCRTADWSNHMPALRSDDSFEQMSTSLLAKYPKLHSMVIRTYILVRHYSAALMTIAG----VP 971
gi 765115906  865 NDVDLYHERTRYFGVSELLETTRSGGCLPLLRYDSSFESMSSALEERFPKLHSAVIRTMVLIQHYCMALVALSGrissSH 944
gi 542244178  873 NDVDLYHERTRYFGVSELLESTHSGSSLPLMRYDPSFESMAATLEERFPKLHSAVIRTTVLIQHYCVALMAVSGrfnrSH 952
gi 768956703  854 NDVDLYHERTRYFGVSELLESTHSGSSLPLMRYDSSFESMASALEERFLMLHSAVIRTTVLIQHYCVALMAVSGrigdSD 933
                        1210      1220      1230      1240      1250      1260      1270      1280
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 513178970  912 QMKNYTSVETLEITQNLINSSRQCPSGHGLMVVLRIPCTPLAAVAYERLYNVRERLALEDNFEIILGNPNSGITIGKHFV 991
gi 556977479  926 QMKNYTSVETLEIIQNLINSPGQCSSSHGHMVLLRIPSVPLAAVAYERLCQVRERLGLEHHFEVILGNPNTGITIGKHFV 1005
gi 403265205  927 SLRDHSTPETLSIMDDLISSPGRNKSGRGHMLIIRVPSVQLAMLAKERLQEVRNKLGLQYRFEIILGNPASELSVATHFV 1006
gi 733882421  979 SLRDHSTPETLSIMDDLITSPGKDKNGCGHMLVIRVPSVQLAMLAKERLQEVRDKLGLQYRFEILLGNPASELTVAKHFV 1058
gi 260829285  972 GAQEKTTTETLNMLQDVVNAPLTSPGGQGSMLLLRVPSIQLAMVAYDKLHSVRDKLGLQYRFDVILSSANTDLTLEEYFL 1051
gi 765115906  945 NLHKHTSVETMEIVQALLTAAQQCPSHHGHMVLLRIPSLALAEWAHRRLCRVRKQLDLENCFEIILGNPSQTLTIRQHFT 1024
gi 542244178  953 NLQKHTSVETMEIVQSLVNAAQQCPAHHGHMVLVRIPSLALAAWAHQRLSRVRKQLGLEENFEIILGNPKQDLNIGQSFT 1032
gi 768956703  934 HLHKHTSVETLEITQSLFTAAQQCPSRHGHMVLLRIPSPALAEWAFRQLCRVRRQLGLEHSFEIILGNPNQPLNIGQSFV 1013
                        1290      1300      1310      1320      1330      1340      1350      1360
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 513178970  992 EQLKVWQKIED-----VDWRPQTYLELEGLPCILIFSGMDPQGESLP----------------RSLRYCDLRLINSSSLV 1050
gi 556977479 1006 EQLKMWQKIED-----TEWMPHTYLELEALPCILIFTGMDPQGESLP----------------RSLRYCDLRLINSAYLE 1064
gi 403265205 1007 ARLKTWRGNEP-----EEWIPRTYQDLDGLPCIVILTGKDPLGESFP----------------RSLKYCDLRLIDSSYLT 1065
gi 733882421 1059 TRLKAWRGNEQ-----DDWIPRTYQDLEGLPCIVILTGKDPLGETFP----------------RSLKYCDLRLIDSSYLT 1117
gi 260829285 1052 KRMQAWRGELDnperkSSWVPRTYCDLDGLPCILILCGKDPLGETMPrsgchepfidvslpmfRSLKYCDLRLVNHGHVT 1131
gi 765115906 1025 NQIKTWLKDQD-----CDWVPHTYLELEALPCILILSGAEPLGESLP----------------RSLKYCDLRVISCSYLH 1083
gi 542244178 1033 DQIKKWLKIQD-----ADWVPRTYLELEALPCILILSGAEPLGESLP----------------RSLKYCDLRVISCSYLQ 1091
gi 768956703 1014 DQIKKWLKIQE-----ADWVPRTYLELEALPCILILSGAEPLGESLP----------------RSLKHCDLRVISSSYLQ 1072
                        1370      1380      1390      1400      1410      1420      1430      1440
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 513178970 1051 RTTLEQELGLAAYFVSSEI--HTEKAVVNDVIESD--PEKLSSTDNEDEEIATEGST----------------------S 1104
gi 556977479 1065 RTALEQELGLAAYLLRSDL--SREMVVVSDLSESD--PEKLSSTDFEDEEIVIEDHA----------------------S 1118
gi 403265205 1066 RTALEQEVGLACCYVSKEV--IRGPTVALDLSGKE--QERAAVSENDSDELLIDLERpqsnssavtgtsgsimengvsss 1141
gi 733882421 1118 RTALEQEVGLACCYVSKEV--IRGPIVALDLSEKE--HEKANGSENDADELLIDLDRpqsn------------------- 1174
gi 260829285 1132 RASLEQEISLGCRYISRDV--VNEPITVCDMSDED--SQSDSEMDNDDGDLQIDTDRprsnssdvqqtspgfsgnqaqhN 1207
gi 765115906 1084 RTTLEQELGLAAYLVKAESrpPHKPGPGSDVIESDpePEKLSSTDNEEEEAQENGETllqstqpvlsc-qksaaecvpaQ 1162
gi 542244178 1092 RTTLEQELGLAAYLVKKESrpPQNLGSGSDLLESD--AEKLSSTDNEEEEGQDNGEPsqplqacpd----sgaldlnpaQ 1165
gi 768956703 1073 RTNLEQELGLAAYLVRAEPrlQHNPSSGSDTLESD--AEKLSSTDNEEEEEQ-NDDSplsssqqlq----scsdtgaadA 1145
                        1450      1460      1470      1480      1490      1500      1510      1520
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 513178970 1105 EK---RSP------MKRERSHSHDSASSSLSSKASITAFCS--Ep---SPPLVTAGDRAKSPHQVlsNSTEETTNNHE-- 1168
gi 556977479 1119 AK---RSP------IKRQRSHSNDSASSSLSSKASNSAFSS--K----SSSASATENTTKSPHPSlvNSTEGSVHNKG-- 1181
gi 403265205 1142 stadkskK------QSLTPSFQSPATSLGMDEGVSAST-----P-----------GTGARETL--------------K-- 1183
gi 733882421 1175 --------------ssavTGTSGSLADNGVSSSSAADKSQKqaPslnfQMVAHSSVDEGTYPG-------FTAGDTLK-- 1231
gi 260829285 1208 GS---VSdstrnpnDNVGRSSPDSAQDSGKESQGNSVPEMS--P---------------QQPQASvtSLQGMVENSIDmi 1267
gi 765115906 1163 ST---TSP-------NVQK-GAFDTLPFLSKAQAQPQPS----SqsfpYAPTAPQNQAQ--------------------- 1206
gi 542244178 1166 ST---TSP-------NVEK-VALDAIQSSSQSQTQLQPQFS--SqsfpCPQTAPESQTQ--PYAPcySQSQQISQLQS-- 1228
gi 768956703 1146 ST---TAP-------NVLK-GTVDNV------QSQTPPA----Sqs-fpHPTPPVHQTH--PHMHsySQEQPTSQLPP-- 1199
                        1530      1540      1550      1560      1570      1580      1590      1600
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 513178970 1169 --RQKQKVDKGAQTTISKHLPPGNEQLDTkqniksaqiSITSSSSSPFSSSSSSSA---Pthns---filqTSQCSMTKS 1240
gi 556977479 1182 --SKKNQVDRKTQRIYNVNHSLAKEPIDCis-----tiNKSARKPPKSTSSASSST---Ptynif--vsqpSSQCSMAKA 1249
gi 403265205 1184 --QECDSLG----PQM-----------------------ASSTISKPSSSSSGPRTlpwP-----------GQPIRGYQG 1223
gi 733882421 1232 --QECDSLG----NQM-----------------------ASSTTSKLSSLSSVSQTfrwP-----------GHSTKDSKA 1271
gi 260829285 1268 ygKEKNSNSHEGDADLPNEPFEQREAAAA---------RDRSGTSPMASVKSSVSKdnvPttstssvgqhkPPASRIAGS 1338
gi 765115906 1207 -----------------------QAPVSH---------QMPPKSTSSDSSSPRASS---P-----------HQNCSWARG 1240
gi 542244178 1229 --QTQIQLLSQTNPQPYLQIPPQQPLLSQm--------QIRSKSTSSGSSSPRASS---P-----------HPSCSWARG 1284
gi 768956703 1200 --QPPVQ----------------------------------------------SSS---P-----------HRSCSWARG 1217
                        1610      1620      1630      1640      1650      1660      1670      1680
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 513178970 1241 SKQ--PPIVFLPKLVYDIITSTDSSGLPKSSSLLPYHSVMWASSFRPLMSKMMTCTEQSLYYRQWTVPKPIHMDYNNRNE 1318
gi 556977479 1250 LQQ--PPIVFLPKAIYDIVTSIDSSGLPKSASFLPYHSVSWVSSFRPLLSKMMTCTEQSLYYRQWTVPKQIHMDYNNRVE 1327
gi 403265205 1224 PHTalPPVVILSKAAYSLLGSQKSGKLPSSSSLLPHADVAWVSSLRPFLNRDMSSEEQSLYYRQWTSARQHHADYSNQPD 1303
gi 733882421 1272 LRAalPRIVILSKAAYCLLSSQKSGNLPSSSSLLPHADVSWLSSLRPLLHKDMSSEEQSLYYRQWTTARQHHADFSNQGE 1351
gi 260829285 1339 SLL--PVTIIVSKTAYDILRP-DPQGKQRHISLQPHPDVGWICPLRPMLLGEVTNEVQSAYYRQWTEPLQHHMDTDNKGE 1415
gi 765115906 1241 VGR--PPSVLLPRALYDIITVSDSSGLPRCTSFLPHIYVAWASSFRPLLSKMMTCTEQSLYYRQWTVPQSNHMDSSNRTE 1318
gi 542244178 1285 ASR--PPSVLLPHALYNVITASDSSGLPRCTSFLPHMSVAWASSFRPLLSKMMTCTEQSLYYRQWTVPRSYHMDSSNRTE 1362
gi 768956703 1218 VRR--PPSVLLPRTLYNVITASDSSGLPRCTSFLPHMSVAWASSFRPLLSKMMTCTEQSLYYRQWTVPRSYHMDSNNRTE 1295
                        1690      1700      1710      1720      1730      1740      1750      1760
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 513178970 1319 --GRMDTFHPRRLLLSGPPQIGKTGAYLQFLSILSRMLIRLTEVDVYDEEEININIKEESDQCYHQPGDT------WPDL 1390
gi 556977479 1328 --GRTDNFHPRRLLLSGPPQVGKTGAYLQFLSILSRMLIRLMEVDVYDEQEISINMQEESAHHYHQPGAL------WPDL 1399
gi 403265205 1304 paSGTRTFHPRRLLLTGPPKVGKTGSYLQFLRILFRMLIRLLEVDVYDEEEINTD-HSESTEVSQSEGEP------WPDI 1376
gi 733882421 1352 a-SSSRSFHPRRLLLTGPPQVGKTGSYLQFLRILFRMLIRLLEVDVYDEEEINAN-HTESSEIAQSSNDH------WPDI 1423
gi 260829285 1416 --NSLPVFHPRRLLLSGPPQVGKTGAYLQFLRVLFRMLIRLLEVEVYNEEEINMDRESPAVSLVYNDNQTthltakWPDY 1493
gi 765115906 1319 --GRSDNFHPRRLLLSGPPQVGKTGAYLHFLGILSRMLIRLMEVDIYDEEDINNSVQAECVQ-FHPPNAP------WPKM 1389
gi 542244178 1363 --GRSDNFHPRRLLLSGPPQVGKTGAYLHFLGILSRMLIRLMEVDIYDEEDINCNSQTEGVQ-YHPASAP------WPNP 1433
gi 768956703 1296 --GRSDNFHPRRLLLSGPPQVGKTGAYLHFLGILSRMLIRLMEVDIYDEEETNCSVQLQEVQ-YHPPNTS------WPNP 1366
                        1770      1780      1790      1800      1810      1820      1830      1840
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 513178970 1391 ETFKKIPFDYTIHDPKYEDASLICSK-LQTVNSEDRP--ISRRQEDMYTHRQTTRMRLSKYAAYNTYHHCEQCHQYMGFN 1467
gi 556977479 1400 ERFKKMPFDYTVHDPNYEDASPVFSK-LCNLESKEKV--SGRKQEDIYLRRHTTRMRLSKYAAYNTYHHCEQCHQYMGFS 1476
gi 403265205 1377 ESFSKMPFDVSVHDPKYSLMSLVYTEkLAGVKQEVIK--E--SKVEEPRKRETVSIMLTKYAAYNTFHHCEQCRQYMDFT 1452
gi 733882421 1424 EIFSKMSFDLSVHDPKYRNISPVYTEqLSRIKQETSKemKSEEP----KKRETVSMMLTKYAAYNTFHHCEQCHQYMDIN 1499
gi 260829285 1494 EFVRSMPFDANLHEGKYMSCSPVYTG-------AEKKdnSPAVNKD--SRRPTMSIMLSKFSAHNSFHHCEHCHHYMESV 1564
gi 765115906 1390 DIMKRMPFDYIIHDAKYDDISSIYCP-GYKPVAER----NPLRQEDVYLRRRTSRIKLSKYAAYNTYHHCEQCHQYLGFN 1464
gi 542244178 1434 EIVRTMPFDYTIHDSKYDDISTIYCP-GYKSNSEG----NPVRKEDVYLRRRTARIKLSKYAAYNTYHHCEQCHQYLGFN 1508
gi 768956703 1367 EIMKTIPFDYTVHDPKYDDISSVYNP-AYKLSDEG----NPVCQEEVFLRRRTCRIKLSKYAAYNTYHHCEQCHQYLGFN 1441
                        1850      1860      1870      1880      1890      1900      1910      1920
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 513178970 1468 PRYQLYESTLHAFAFSYSMLGEEIQLHFIIPKSKEHHFVFSQPGRQLESMRLPLVTDKSEDFIKSPTFTPTTGRHEHGLF 1547
gi 556977479 1477 PRYQPYESTLHAFAFSYSMLGEEIQLHFIIPKSKEHHFVFSQPGGQLESMRLPLVTDKNPDYIKTPIFTPTSGRHEHGLF 1556
gi 403265205 1453 SASQMSDSTLHAFTFSSSMLGEEVQLYFIIPKSKESHFVFSKQGKHLESMRLPLVSDKNLNAVKSPIFTPSSGRHEHGLL 1532
gi 733882421 1500 PAAQVSDSTLHAFTFSSSMLGEEVQLHFIIPKSKESHFVFSKQGKHLESMRLPLVSDKNLNAVKSPIFTPSSGRHEHGLL 1579
gi 260829285 1565 APQQTRESSLYSFTFPSAVYGEEVRLHFIIPQTQEKHFVFSKQGHHLESLRLPSLEDAGHNDIKTPIFTPTCSRQEHGLL 1644
gi 765115906 1465 PRYQIYESTLHAFTFTHLLLGEDIQLYFIIPKSKEHYFSFSQQGGQLESMRLPLASEQNPDCIKTPIFTPTTGRHEHGLF 1544
gi 542244178 1509 SRYQMCESTLHAFTFTHLLLGEEIQLYFIIPKSKEHYFSFSQPGGQLESMRLPLTSDWSPDCIKSPIFTPTTGRHEHGLF 1588
gi 768956703 1442 HRYQMCESTLHTFTFTHLLLGEEIQLYFIIPKSKERYFSFNQSGGQLEGMHLPLTSDRSPDCIKSPIFTPTTGRHEHGLF 1521
                        1930      1940      1950      1960      1970      1980      1990      2000
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 513178970 1548 NLYHAMDGASHLHVLVVKEYEMAIYKKYWPNHIMLVLPSIFNSAGVGAAHFLIKELSYHNLELERNRQEELGIKPQDIWP 1627
gi 556977479 1557 NLYHAMDGATHLHILVVKEYEMAVYKKYWPNHIMLVLPSIFNTAGVGAAHFLIKELSYHNLELERNRQEELGVKPQDIWP 1636
gi 403265205 1533 NLFHAMEGINHLHLLVVKEYEMPLYRKYWPNHIMLVLPGMFNNAGVGAARFLIKELSYHNLELERNRLEELGIKRQCVWP 1612
gi 733882421 1580 NLYHAMEGISHLHLLVVKEYEMPLYRKYWPNHIMLVLPGMFNNAGVGAARFLIKELSYHNLELERNRLEELGVKRQCVWP 1659
gi 260829285 1645 NLFHAMEGGRHTHMVVVKQCEMALYQKFWPNHIILVLPVVCNDAGIGAARFLVKELAYYNLELERNRQEELGVRRQDVWP 1724
gi 765115906 1545 NLYHAMDGASHLHILVVKEYEMAVYKKYWPNHIMLVLPTIFNGAGIGAAHFLIKELSYHNLELERTRRLEGGSPA-DVWP 1623
gi 542244178 1589 NLYHAMDGASHLHILVVKEYEMAVYKKYWPNHIMLVLPTVFNGAGIGAAHFLIKELSYHNLELERSRRLEGGGPAGDVWP 1668
gi 768956703 1522 NLFHALDGASHLHILVVKEYEMAVYKKYWPNHIMLVLPSVFNGAGIGAAHFLIKELSYHNLEMERSRRLEGGGPAGDVWP 1601
                        2010      2020      2030      2040      2050      2060      2070      2080
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 513178970 1628 FIVISDDSCVMWNAVEVDCSG--DRKSD-YTWTERNVSLKHILQRIEATPNVTHYALIGMRKWSSKTNT-AEIKEPFSCC 1703
gi 556977479 1637 FIAIADDSCVMWNVVDFNRNR--EASSE-DIWTERNVSLKHVMQRIEETPNVIHYALLGMRKWSNKESS-KRIQEPFSRC 1712
gi 403265205 1613 FIVMMDDSCVLWNIHSVQEPS--SQPME-VGVSSKNVSLKTVLQHIEATPKIVHYAILGIQKWSSKLTS-QSLKAPFSRC 1688
gi 733882421 1660 FIVVMDDSCVLWNMHSAHEQS--SQSLE-PGGTSKNVSLKNVLQHIEATPKIVHYAILGVQKWNSKLNA-KKTKAPFSRC 1735
gi 260829285 1725 YVIIMDDSLVMWNMHDSTQED--KQT--------QNISLKSVIQHLEATPKITHFSMLGARQWSGKSTV-DVSMQPFSRC 1793
gi 765115906 1624 FIILADDSCVMWNAVDLDARS---------GPVEHAVSLKQVLQHMEACPELAQYSLCGIRKWSSRGLKgSKRWEPFFRG 1694
gi 542244178 1669 FIILADDSCVMWNTLDLEARN---------GPVEHAVSLKQVLQHMEACPDLSHYGLCGIRKWSR--LTgNVLREPFSRG 1737
gi 768956703 1602 FIILADDSCVMWNVVDLDTRNffLLSATfSGPAEQAISLKQVLLHMEGCPDLAHYGLCGIRKWTSRTLTgNKHREPFSRG 1681
                        2090      2100      2110      2120      2130      2140      2150      2160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 513178970 1704 HVHDFIMLNVDLTQNVQYNQNRFTCDDVDFNLRVHSAGLLICRFNHFSVMKKQIAVGGQRSFHIKSKVSD--IPVSISPA 1781
gi 556977479 1713 HLHDFILLNVDLTQNVQYKQNRFTCDDVDFNLRAHSAGLLICRFNCFSVMKKQIAIGGHRTFHIKSKVPD--VSTSVSPS 1790
gi 403265205 1689 HVHDFLLLNIDLTQNVQYDFNRYFCEDVDFNLRTNSSGLLICRFNNFSLMKKHVQVGGQRDFIIKPKIMVseNLAPILPL 1768
gi 733882421 1736 HVRDFILLNIDLTQNVQYDLNRYFCEDIDFNLRTNSSGLLICRFNNFSVMKKHIQVGGQKDFVVKPKIVVsdSPAPIMPL 1815
gi 260829285 1794 HLHSFIMLNVDATQNVQYDQNRYNCEDIDFNMRISSGNGLLCRFNRFSFMKKAIHVGGGMDFPMKPKVANa-NTQNITTR 1872
gi 765115906 1695 HLYDFLLLNVDRSQNVQYDQNRFTCHDVDFTLRLHSAGLIVCRFNNFSVMKKQITIGGYKTFIIKTKMTD--VPTSVGPS 1772
gi 542244178 1738 HLHDFFLLNVDRSQNVQYDQNRFTCHDVDFTLRLHSAGLLVCRFNNFSVMKKQIAIGGYRTFIIKTKMTD--VPTSVSPS 1815
gi 768956703 1682 HLHDFLLLNVDQSQNVQYDQNRFSCHDVDFGLRLHSAGMLVCRFNGFSVMKKQISIGGYRTFVIKTKVSDdpVPTSVGPS 1761
                        2170      2180      2190      2200      2210      2220      2230      2240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 513178970 1782 QYICAPDSKHTF-LAAPAQLLLEKYLQYHSHRFFPLSLKNYRHPVLSVDCYLNLGPQIAVCYVSSRPHSLNISSSGLTFS 1860
gi 556977479 1791 QYICAPDSKHTF-LAAPAQLLLEKHLQYTSHCFFPLSLKNYNHPVLCVDCYLNLGAEISVCYVSSRPHSLNINCSGLEFS 1869
gi 403265205 1769 QYICAPDSEHTL-LAAPAQFLLEKFLQHASYKLFPKAIRNFKSPVLAIDCYLNIGPEVAICYISSRPHSSNVNCEGVFFS 1847
gi 733882421 1816 QYVCAPDSEHTL-LAAPSQFLLEKFLQHATYKLFPKAIHNFKNPVLAIDCYLNIGLEVAICYVSSRPHSVNVNCEGVFFS 1894
gi 260829285 1873 QFVAAPDSEDLVpLVAPPQFLLEKYLAHESKALFPMAMDNHLTPVLAIDCYLNLGAQISVAYMSSRPHSVNTDTD-CRFS 1951
gi 765115906 1773 QYICAPDSKHLF-LATPAQLLLEKYLQHTSQKLFPLSIKNYANPVLSVDCYLNLGPEVTVCFMSSRPHSVNISTTGLLFS 1851
gi 542244178 1816 QYICAPDSKHLF-LATPAQLLLEKYLQHNSHKLFPLSTKNYTHPVLSVDCYLNLGPEVTVCFVSSRPHSVNISTAGLLFS 1894
gi 768956703 1762 QYVCAPDTKHLF-LATPAQLLLEKYLQHTSQKLFPLSTRNYTHPVLSVDCYLNLGPEVTVCFVSSRPHSVNINTTGLLFS 1840
                        2250      2260      2270      2280      2290      2300      2310
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 513178970 1861 GLLLYLCDSFVVASFLKKFHFLKGATLCVICQDRNSLRQTVVRLELEDEWQFRLRDEFQTANAKEDRPLFFLTGRHI 1937
gi 556977479 1870 GLLLYLCDSFVTASFLKNFHFMKDATLCVICQDRSSLRQTVVRLELEDEWQFRLRDEFQTANSKEDRPLFLLTGRHI 1946
gi 403265205 1848 GLLLYLCDSFVGADLLKNFKFLKGATLCVICQDRSSLRQTIVRLELEDEWQFRLRDEFQTANSSDDKPLYFLTGRHV 1924
gi 733882421 1895 GLLLYLCDSFVGADLLKRFRFLKGATLCVICQDRSSLRQTIVRLELEDEWQFRLRDEFQTANSSDDRPLYFLTGRHI 1971
gi 260829285 1952 GLLLYLCDSFVMADFLKKFNFVPGATLCVICPDRNTLRRQIARLELEDQWRFRLRDEFQTANTAEDKPLYFLTGQHI 2028
gi 765115906 1852 GLLLCFADAFVTSGFLKKFTFLKGATLCVISADRSSLRQTVGRLELEEEWRFRLSDEFQTANAKEDRPLFFLTGKHI 1928
gi 542244178 1895 GLLLCFADSFVTPGFLKKFTFLKGATLCVISADRSSLRETVGRLELEEEWRFRLSDEFQTANAKEDRPLFFLTGKHI 1971
gi 768956703 1841 GLLLSFADSFVTPGFLKKFSFLKGATLCVISADRSSLRKTVSRLELEEEWRFRLSDEFQTANAKEDRPLFFLTGKHI 1917
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap