Conserved Protein Domain Family
FSIP2

?
pfam15783: FSIP2 
Fibrous sheath-interacting protein 2
FSIP2, fibrous sheath-interacting protein 2, is the C-terminal portion of a family of proteins found in mammals. The function is not known but the domain appears to be repeated up to 10 times in some members.
Statistics
?
PSSM-Id: 318078
View PSSM: pfam15783
Aligned: 18 rows
Threshold Bit Score: 1486.92
Threshold Setting Gi: 884941225
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 300669711  5901 SSDKIPSIDKTLVNKVVHSSVCNILNDYGSQDSIWKNINSNGENLARRLTSAVINEIFQRQVNLIFCDEVSVSACLPLES 5980
gi 300669692  5998 ALEKIPSIEKSIVNKIVHSCVCNIFKECKSQESICENINSNGENLAKRLTSTVINEIFQHQLNLIFSDEVPASACVPLES 6077
gi 1032950507 5874 SLHRMPSIEKSVVNKIVHSCVCNVLKECTSQESVCKNINSNGENLAKRLTSTVISEIFQHQLNLMFSDEIPASACVPLES 5953
gi 884941225  5817 FLDELPLIDKTLVNKVAHSSICNILKEYRTQEALYQDIKNNEDNLVKRLTSGVINELFQRQLNLLFGDEVPILAGLPLDS 5896
gi 532077363  5949 SLEKSQSIDKTLVNKVVHSSVCNILKENRSQESICKKINSNRENLARSVTSAVIDEIFQHHLNLIFCDDVPNSACFPLES 6028
gi 1040236717   69 lipKTPSVDKAFISKVVNSSLSSILQQYESQYSICKDINSNGENLAKRLANAVLEEIFQHQLNLLLHDEGLPSICLPLES 148
gi 927223079  5868 dkAKTPTMDKMLVNKIVHSSICNILQEYQSRDLICEDINSNVEKLARRLANAVIEGIFQHRLNLLLYDEVPDSVCLPLES 5947
gi 803203831  3765 FMAKIPSIDKMLVNKVVHSSICNILQDYRSQDSICEDINFNVEKLAKRLANAVIEEILQYQLNLLLYDEVSDSKCLPLES 3844
gi 928183886  5821 SMANIPSSDKRLVNKIVHSSICNILREYRSQDSIYKDINSNGENLARKLANAVIEESFQHQLNLLLYDDVPAAACLPLES 5900
gi 803016840  5727 FLDKMSSIDKTLVNKVVHASVCNILKEYKSQDSICKNIKSNGGHLVRRLTSAMINEIFQHKLNLILCDEFPASSCLPLET 5806
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 300669711  5981 KDVVKKVQKLAQTASKECQTSSPYTIILPHKFLENVISALFSKIFS--TISST--KTKEPEDNLSTELNFLQMKLVSAVA 6056
gi 300669692  6078 KDVEQKVQNVVQTVSKECQTASPYTVQLPYKFLEDVTSGLLAKVFS--KLSNV--KTKLTPENVLTQLDFLQSNLVKTIA 6153
gi 1032950507 5954 KDVEKKVQKAVETASKECQTSSPYTIKLPFKFLDDVISALLAKVFS--KLSNV--KTKISQQTPLTQLDFLQMKLVNTVA 6029
gi 884941225  5897 KDLVKKIEKLPQTASKECQTTSPYTVMLPHQFLEDVISTLLSKIFS--KISNTitKRETSEDKVSTELDFLQMELVSKIA 5974
gi 532077363  6029 KEVVKKVQKVVQTSSKECQTSSPYTIMLPHRFLEDVISALLSKIFNfqSISNSknKEKSPEGKKSTELDFLQMKLVNTVA 6108
gi 1040236717  149 KEFMKKVQKVPQTSCKECQTSRPYTVLLPHEFLENIMSSLLSKIFF--TVANT----SMLQDNLYTELDFLQMKLVGTVM 222
gi 927223079  5948 KEVMKKVQKVAQTACKECQTSSPYTVMLPHEFLERIISSLLSKVFS--VVANA--KAEISEDNLYTELDFLQMKLASTVI 6023
gi 803203831  3845 TKVMKKVHKVAQTACKECQTSSPYTIMLPYEFLERIISSLLSRIFS--TVANA--KTEMSEDNLYTELDFLQMKLASTVK 3920
gi 928183886  5901 KEVMKKVHKGIQTACKECQTSSPYTIMLPHEFLESIISSLLSKIFS--TVARA--KTETSEDNLHTELDFLQMKFVSTIM 5976
gi 803016840  5807 KDVVKKVQKLAQTANKECQTSSPYTIILPHEFLENVISTLLSKIFS--TISNI--KTETYEGSWFTELDFLQMKLLSIVT 5882
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 300669711  6057 TEISQDKYMTIQYVETLQSDDDEIIQLVVQSVYNNLLPQFGSQEIIQNCVTSGCKILSENIVDLVLREVASNQLQSYFCG 6136
gi 300669692  6154 AEISKNEDLIIQYVESLHPNDDEVIQLVVQTIYNNLLPQFGSQEILQKCIISGCKLLSKTIVDLVLREVTGNQLQNYFGG 6233
gi 1032950507 6030 AEIAKNEDMIIQYVESLHPNDDEIIQLVVQTIYNNLLPQFGTQETIQNCIASGCRLLSKTIVDLVLREVAGNQLQNYFGG 6109
gi 884941225  5975 AEISNDEDMIVEYVESLHPNDEEIIELVVQSIYNNLLPQFGSQEIIQNCISNGCRHLSKAIIDLVLREVAGNQLQNYFCG 6054
gi 532077363  6109 EEISRNENMVVKYVESLHPSDDEIIELVVQSIYNNLLPQFGTREVIQNCVASGCILLLETIVDLVLREVAGNQLQNYFCG 6188
gi 1040236717  223 TEISKDECMIIEYVQSLHPNDDEIIQLVVQTIYNNLLPQFGSLANIQNCITSDCRMLSESIVNLVVREVTGNQLQTYFSG 302
gi 927223079  6024 TEISKDEDMIIQFVDSLYPNDDEIIQLVVQTIYNNLLPQFGSQESIQKCLSSGCKILSEAIVNLVVQEVTGNQLQNYFSG 6103
gi 803203831  3921 TEISKDEDMIIQYVKSLHPNDDEIIQLVVQTVYNNLLPQFGSQENIRKCISSGCKILSEAIVNLVVQEVTGNQLQNYFSG 4000
gi 928183886  5977 TEISKDKDMIVQYVQSLHPNDDEIIQLVVQTIYNNLLPQFGSQESIQNCASSGCKILSETIVNLVVQEVAGNQLQNYFSG 6056
gi 803016840  5883 TEISKDENMIIQYVESLHPSDDEAIQLVVQSLYDNLLSQFGSQESIQNCAASGCRILSETIVDLIRREVTGNQLQNYFSG 5962
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 300669711  6137 ELTPHQCVEVENIVEKILKDVFQTTDvplPKPSHAdKLSYNIIEEIAVKFLSKLLSIFPKVHKERTKSLETDMQKITSKV 6216
gi 300669692  6234 ELTPIQCAEVDNVVENILTNVVLTTP---SQPSGPrKLSYNIIETIAVKFLSKLLSVFPKGHPERTKSQETEMRKITSKI 6310
gi 1032950507 6110 ELTPYQCAEVDNVVENILTNVALTTS---PQPPHPrKLSYHVIEAISVKFLSKLLSVFPTVHTVKTKSPETEMQKISSKI 6186
gi 884941225  6055 ELTPYQCAEVDSVVENILSSVLQTTS---TRPAQApKVSSKIIEEIAVKFLSKLLSVFPKVHKKRTKSPETEMQKISSKI 6131
gi 532077363  6189 ELTPHQCAEVDSTVENILKDIIQTAS---PQSSQAhKLSYNVIEEIAIKFLSKLFSVFPKGGKEITKSLENEMQNITLKI 6265
gi 1040236717  303 ELTPHQCTEIDNVVENVLKDIVQTTEvpqCEPPQAhKLPFHIIEEIAVQFLSKLLSVFPTVGKESNKTLHAEMQKIISKI 382
gi 927223079  6104 ELTPNQCTEVDCIVENILKDIIQPTKvlqPRPSRAyKLPFNIIEEIAVNFLSKLLSMFPKAVKKQNNSLYAEMQKITSKI 6183
gi 803203831  4001 ELTPLQCTEIDSTIENILRGIIQTNEvpqPQPSWAyKLPFNIIEEIAVKFLSRLLSMFPKADKEQNNSLNTEMQKISSKI 4080
gi 928183886  6057 ELTPHQCTEIDSVVENILKDVIQTTEvpqPQPSQAyKLPFPIIEEIAVNFLSKLLSMFPKADKKQNNSLNAEMQTIISKI 6136
gi 803016840  5963 ELTPYQCAEVDNVVENILKDVIQTADipqPHPSQAcILPYNIIEEIAVKFLLKLLSVFPKVDKERPKSLETEMQKITSKI 6042
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 300669711  6217 LNSVQEFISKSKIKLVPPTKESPTVPVADNATIENIVNSIYTSVLKHSGSYTSVFKDLMGKSNVLSDTIGFLMVNAISNS 6296
gi 300669692  6311 LHSIQEFISKSKIKVVQPVKESEAVPSADKAAIEKVVNSVYTNLLKHCGSPTSAFEDLMRKSDVISDIIGFSMVKEISNS 6390
gi 1032950507 6187 LKSIQECMSKSKIKVVKPAKELEPEPLADDATIEKVANSVYANLLKHSGSPASVFEDLMGKNNVLPDIIGSLMVKEISNS 6266
gi 884941225  6132 LNSFQEFISRSKIKLTKSATESPTVSSDDSETIENIVNSVYTSILKHSGSHTSVFKDLMGQSNVLSDIIGFLMVKEIYNS 6211
gi 532077363  6266 LKSFQEFISKSKIKLVSPTKESPTVPLADNASIENIVNSVYDNVLKHSGSHTSVFKELMGKSNVLSDIIGFLMVKEISNS 6345
gi 1040236717  383 LDSFQEYMSKSQIKVVPQTKESSTISLAESETIEKVVTSVYNSVLKHSGSHISVYKDLLGKSNFLSDIIGFLMVKEISNS 462
gi 927223079  6184 LSSFQEYISKSQIIVVPQVKESSTVSLADSATIEKVVTSVYNIVLKHSGSHISVYKDLMGKSSVLSDIIGYLMVREISNS 6263
gi 803203831  4081 LSSFQQYISKSHITVVPRVKESSTVSLTDSATIEKIVTSVYSTVLKHCGSHISVYKDLMGKSNVLSDIIGFLMVKEISNS 4160
gi 928183886  6137 LSSFQEYLSKSQITVVPQAKESPTVSLADSTTIEKVVTSVYNSVLKHSGSHISVYKDLMSKSNVLSDIIGFLMVKEISNS 6216
gi 803016840  6043 LNSIQEVISKNKIKVVSPAKEIPTALLANNEAIEKVVNSVYTSILKHSGSLTSIFKDLMGTSNILSDIIGFLMVKEISKS 6122
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 300669711  6297 EFQPQVEEEVSNSELVLEAVKIMEKVIKIIDELKSKEKSSSRKGLTLDAKLLEEVLALFLAKLIRLPSSSSKDEKNLSKT 6376
gi 300669692  6391 EFQPQAEEELSSSELALEAVKIMEKVVKIIDELKSQEKPASITDVMLDSRVLEEALALFLAKLVKTPGPASKDTTSLTKP 6470
gi 1032950507 6267 EFQAQAEEELSSSEIALEAVKIMEKVVKIIDELKSKEKSSSIKDLILDSRVLEEALALFLAKLVKKPGPESKDTDNLTKP 6346
gi 884941225  6212 EFQPQVEEEISSSELILEAVKIMEKVVKIVDKLKSQEDFSSEKCSMLDTKVLEEALALFLAKLVRLPRASQQDTDSLSKS 6291
gi 532077363  6346 EFQLQGGEEVSSSELALEAVQIMEKVVKIIDELKSQEKSSSRKGSVLHAKVLEEALALFLAKLLRLPSASSKDTNNLTKP 6425
gi 1040236717  463 EFHPQVEGEASGSELVLEAVKIMEKVVKIIDDLRSKEKASSRKSVVLDALFLEEILALFLARLAMLPSASSKNTKNLSKF 542
gi 927223079  6264 EFHPQVEEETSSSELVLEAVKIMEKVVKIIDDLKSKKKPSSKKEAVIDARFLEETLALFLAKLVKFPSASSGDPKNLSKP 6343
gi 803203831  4161 EFHPQEQEETSSSELVLEAVKIMEKVAKIIDDLKSKKKPPTEKEAVLDARFLEEILALFLAKLAKLPSASSKDAENLSKP 4240
gi 928183886  6217 EFHPQV-EEASSSELVLEAAKIMEKVVKIIDDLKSKKKPSTRKETVLNARFLEETLALFLAKLVKVPWASSRDVKNLSKS 6295
gi 803016840  6123 KFQPQIQEELSGPELALEAVKIMEKVVKMVDKFKSQEKSSSKKVSMLDAMFLEEALALFLAKIVRLPSESSKHAKNLSKP 6202
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 300669711  6377 ELNKIASQLSKLVTAEISRSSISLIASDPEEHCLNPENTERIYQVVDSVYSNILQQSGTNKEFYyDIKDTNTAFPKKVAS 6456
gi 300669692  6471 ELNKIASQLTKSVTAEISKSNISLVESNHEEQSLDPENIEVISQVVESVYSNVVKQSGTENELS-DIKGTKKAFPKKVAS 6549
gi 1032950507 6347 ELNKIASQLTKSVTAEISRSNISLVDSDPEEQPLDPENIEKISQVIDSVYSNIIKQSGDDNELY-DMKGTKKLFPKKVAS 6425
gi 884941225  6292 ELNKVASQLTKSVTAEVSKSNISLVSSEPEESSSNQEEMDMIFQVVDSVYSNILQQSGSHEELH-DIKDTDTVL-SKVAS 6369
gi 532077363  6426 ELSKIASQLTKNVTAEISKSNISLVAADSEEQSLEPESMEMISQVIDSVYSNVFQQSETNKEFY-DTKDTSIVFPKNVAS 6504
gi 1040236717  543 ELNKMSSQLTKSVTAEISRNNISVVAAYPEEYFLNPENRETVLQIVDSVYNQALQQCGTQEELYyDVKGTNHFFPNKVAS 622
gi 927223079  6344 ELNKIASQLTKSVTAEISRKNISIIAGNPEENFLNPENMEIISQMVDSVYNHVLQQSGTHEELYyDMKGTNHIFPKEVAS 6423
gi 803203831  4241 ELNKIASQLTKSMTAEISRKNISIVAANPEEYFLNPESIEIISQMVDSVYNCVLQQSGTHEELYhDMKDTNHIFPKEVAS 4320
gi 928183886  6296 EVKKIASRLTKCVTAEISRNNINVVSTDPEETFLSPESIEIISQMVDSVYNQVLQQSGTHEELYyNMKGTNNVFPKEIAS 6375
gi 803016840  6203 ELNKIASQLTKSVTAEISKSNINLVATDSEGYFLNPESIEMVSQVIDSIYSNVLQQSGSQKDLYhDIKSTNRVFPKKVAN 6282
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 300669711  6457 LIIDGVSSFPLDTINSTISNADLSGELDVNRIVQKAQEHAFNVIPELEQeKldQNLSEEESPIKIVPHVGKKPVKIDPKI 6536
gi 300669692  6550 LIVDGVSSVPSCRVITESSYTAAHGDLDTNRIIEKAQKHAALMSSDSDKdS--KKELEDEFPVRIVPHVRNKPLRIDPNI 6627
gi 1032950507 6426 LIVNGVSNVPSCRVITKSSDAGVFGDLDTNRIIEKAQKHAARMNSDSDKeL--DDVVEDELPVRIIPHIGNKPLKIDPNI 6503
gi 884941225  6370 LIIDGVSKVPLDMVTSTSSISGIFQDLDIDRIIEKTEKHAKKM---MDDkKsrEDRSREECTVVIIPHVGRKAIKVDPQI 6446
gi 532077363  6505 LIIDGVSSVSSDSINTKNSNSHFCGELDVNRIVDKAQNHVLKIMPELDNeEp----dEENSTIKIVPYLGKKPIKIDPEI 6580
gi 1040236717  623 LVFSKVLNCPLETVSSKDSCTDFFKDLDVHQIAEKAYEYAVKGKPIPEGkKsdHNLTKEKLPIRIIPHHGKKPINIDPNI 702
gi 927223079  6424 FIIRKVSNCALETISPKASCANLFGDLDVGQIVEKVQEHVLRTEPEPEPkGfdQELREEELSVK---XRGKQPINIDPDI 6500
gi 803203831  4321 LIIRKVSSCPLAMISSGDPCANLFGDLDIDRIVEKVHEHAIKIEPGLEQkGldQGLRQEELSVRIIPHLGKEPINIDPDI 4400
gi 928183886  6376 LLISKVSSCSLETVSPKDSQADLFSDLDIDQIVKKVHEYAVKSQPELEQkEldQDVSEEELPIKIVPHRGKQPINIDPDI 6455
gi 803016840  6283 LIVNEVSNFPFDSASPKNSNACFLGDLDINRIVEKAQEHAVNMIPDLDK-KstKDSIVEDFAIKIIPHVGNKPLKIDPNI 6361
                          650       660       670       680       690       700       710       720
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 300669711  6537 ISEHLAVISIKTQPLEKLKQECLKRTGHSIAELRRASISGRNYSL-GSPDLEKRKTERRTSLDKTGRLDVKPLEAVARNS 6615
gi 300669692  6628 VSDHLAVISMKTQPLETLQMDCLKRTGCSIAELRRNSIRGIGPSStDVSEMGTRQKERRISLDRTGRLDVKPLEAVGRNS 6707
gi 1032950507 6504 IAEHLAVISMKTQPLETLKMDCLKRTGYSIAELRRASISGKGHSStEVCEMGTRQKERRISLDRTGRLDVKPLEAVGRNS 6583
gi 884941225  6447 ISQHLAVISVKTEPLEKMKLECLRRTGHSIEELRRASIDGRSLAAtSPAVSENRKKERRTSLNSTGRLDIKPYEAVCRNS 6526
gi 532077363  6581 VSEHLTVLSVKTQPLEKLKMECIRRTGHSIAELRKASISGKSYSStEPIDSEKRQKERRTTLSKTGRIDIKPLEAVCRHS 6660
gi 1040236717  703 VAEHLGVISIKTQPLEKLQMECLAKTGHSIEALRSAMISGRSYSI-GLAAAEPKKKERRISLDMAGRLNVKPLEIASRNS 781
gi 927223079  6501 VAEHLGVLSIKTQSIEKLQRECVARTGHSIETLRRVSISGRSYST-DAPYS--KKKERRVSLDQAGRLDVQPLETASRNS 6577
gi 803203831  4401 VAEHLGVISIKTQSLKKLQTECLTRTGHSIETLRRASINGKRYST-EITAAGNRKKEKRISLDQMGRLNVKPLEASSRNS 4479
gi 928183886  6456 VAEHLGVLSIKTQPLEKLQLECLTRTGYSIEALRRMSVSGRSHSV-DISDAGKRKQKKRVSLDEVGRLNLRPLEAASRNS 6534
gi 803016840  6362 ISEHLAVISIKTQPLEQLQTECLKNTGHNIAELRRASISGRSRPS-NTFTIRELKRERRTSLNKIGRLDIKPFEAVCRNS 6440
                          730       740       750       760       770       780       790       800
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 300669711  6616 FQNIRKPDITKVELLKDVQSKNDLIVRLVAHDIDQVYLENYIKEERd-SDEDEVVLTQTFAkEEGI-KVFEDQVKEVKKP 6693
gi 300669692  6708 FQNVRRPDITRVELLKDINNKTDLIIRLVAHDIGRKESDSSLSEGMv-SDEEEVVLGEVVG-DQCLrKISGGRVQQVKKS 6785
gi 1032950507 6584 FQNVRRPDITRVELLKDIHNKKDLIVRLVAHDISKNDLEGSFREDMv-SDEEEIVLGEVAG-HQCLgEISGDHVGEVLKP 6661
gi 884941225  6527 FQNIRKPDISKVELLKDVQNRKDLIIRLVAHDIYQEDEEAFTEGDTm-YDENEVVLGEYFG-LRTIgELSEDEVKGVMKL 6604
gi 532077363  6661 FQNIKKPDITTVELLKDVQTSKDLIIRLVAHDINQEHPGNNVAEEVi-SDEDEIVLGEVAV-QRSLgELSEDQEKEFGMT 6738
gi 1040236717  782 FQNLTKPDITKVELLKDVLNKKDLIIRLVAHDISHEGSECNTEENLt-SDEDEVVVQEILSd-----SLFEDQVKEDRKP 855
gi 927223079  6578 FQSLIKPDITKVELLKDVQTKKDLIIRLVIHDINQEVLEKKAEEILt-SDEDEVVLGEVVK--ELPeGPLEDQVKEDVKP 6654
gi 803203831  4480 FQSLIKPDITKVELLKDVQSKKDLIIRLITH-ISQENLENK-EESLa-SDEDEVVLQEVIKeEEFPeSPLEDQVKEDMNL 4556
gi 928183886  6535 FQNLIKPDITKVELLKDVHSKKDLIIRLVTHDIGQEVSENKVEEGLt-SNEDEVVLQNVVK-EELPeDLFDDQAKEEIKP 6612
gi 803016840  6441 FQNIRKPDITKVELLKDVQNKKELILRLVAHDIEQEISESNIEEELtsSDEDEVVLREIV--QEHSgENIEDQVKDSTKP 6518
                          810       820       830       840       850       860       870
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 300669711  6694 IQSKL-SPKSTLSTSSLKKFLSLSKCCQTTASANIESTEAISNQVIESKETHVKRAVAELDMATPKtMPETASSSWE 6769
gi 300669692  6786 AESHVvSSKTATSTSNLKRFLALSKCCQPTSGENIESIEESGIQIMDPNKAYVKRAAAELDMPSCKsLAEETTSRDK 6862
gi 1032950507 6662 SETQVvSPKTTTSTSSLRKFLALSKCCHPTSGEHIESIEATGNQTMEPSKTHVKRAVAELDMPSSKiLAEGPSSSDK 6738
gi 884941225  6605 MQRRGiSSIPTATTSR----------SQSTSTSDAQGVRGTSNQ-TEPIKTQLSRIAGECSMTTSTvLTETPASTNK 6670
gi 532077363  6739 VASKVaSSKTIISASNLKKILSISKCCQNTNGVNTESIETTSNLILESHDTQVQGIASEIDMPFSK-TLTETDSSPQ 6814
gi 1040236717  856 PASSKsSPKPSQNKSTLKKFLSLGKCCRYITTLSTKSTEASPIPCTDPKETEI-KNISVANKATLKsSTIADSSFQE 931
gi 927223079  6655 TASTLaFPKPLVSKSNLKKFLSLGKC-QPKPGVTAI-TEASPIQQIKSEQTQL-RTVSN-DLTTSTfLTNTNSSSWE 6727
gi 803203831  4557 TTSTVaHPKPPISKCSLKKFLSVGKC-QPKSSVTII-PEVSPAKQTEYEQTL--RSVSSIDVTTSKcLTVTNSP-WE 4628
gi 928183886  6613 IMGTVaLHKPLISKRNLKKFLSLGKCCHRRSTVTTTNTEASPTLWTESEETQQ-RLVSNTDVTTSKsPTGTDSSFWE 6688
gi 803016840  6519 VESKVvSPKPTQSTSSLKKFFSLSKCCQPTSNANVEHTGTMSNHVIDAKKGQIKRTIAELDMSPCSgTFTETDSTWE 6595
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap