Conserved Protein Domain Family
CCDC106

?
pfam15794: CCDC106 
Coiled-coil domain-containing protein 106
CCDC106, coiled-coil domain-containing protein 106, is a family of eukaryote proteins. Yeast two-hybrid screening has identified CCDC106 as a p53-interacting partner. CCDC106 is a negative regulator of p53 and may be involved in tumorigenesis in some cancers by promoting the degradation of p53 protein and inhibiting its transactivity.
Statistics
?
PSSM-Id: 318088
View PSSM: pfam15794
Aligned: 10 rows
Threshold Bit Score: 206.542
Threshold Setting Gi: 542201379
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 597755038   26 MLTITKLQCLLESKQEKIESLERQVEDLQQDRKFLRQQIENLTSSRS-------Gp-aPEAS------------------ 79
gi 410911334   79 FILVSNLRAHLYVALEKNAWLQKRIEELEEERNFLRCQLDRFIVSMRs-----sEdwcGDSQ------------------ 135
gi 1041096176  71 YMVITNLRTQLQISLEKNSWLQKRIEDLEEERDFLRCQLDRFIFSTKs---------qGQEQsqnqysngyesrrftwra 141
gi 565322366   76 LTLVTSMKTQLHMALERNSWLQKRIEDLEEERDFLRCQLDKFISSARl-----dA---DDHC------------------ 129
gi 94536856    55 LALMNSVKTQLHMALERNSWLQKRIEDLEEERDFLRCQLDKFISSARm-----eA---EDHC------------------ 108
gi 512854631   55 IILMNSMKTQLHMALERNSWLQKRIEDLEEERDFLRCQLDKFISCTKs-----dS---EEHS------------------ 108
gi 557007817   81 QMFMTNLRNQLNLTLEKNSWLQKRIEDLEEERDFLRCQLDKFISSTKs-----dAv-sEYES------------------ 136
gi 542201379   56 TALLNKEQEELTFLKEKLEWQKMRIEELEGERDFLRRQLSSFTK------------------------------------ 99
gi 1040662818 216 qlSLEQAKKTIEIQKEKILHLQEKVDFLMDDRNYLRSRLEDAL---------------RLRC------------------ 262
gi 768931313   82 llTITKLQCMLESKQERIAALEKQVEDLMQDRKFLRTQVENLTSSRSmqafappTe-aPKPS------------------ 142
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 597755038   80 --------KSVYTE--------------PKAHKR---------------------------------------------- 91
gi 410911334  136 --------RSVKGQpagspsppspmttrSGMTLK---------------------------------------------- 161
gi 1041096176 142 rreddrpaEQQKAD--------------SQHFPSrqfiqrrpgpptmvssknhissplstqltsmnalfnstqsqallqg 207
gi 565322366  130 --------CKKKLP--------------RRAEIM---------------------------------------------- 141
gi 94536856   109 --------RMKPGP--------------RRME-G---------------------------------------------- 119
gi 512854631  109 --------RIKQTN--------------WR---S---------------------------------------------- 117
gi 557007817  137 --------RMKQNL--------------R--------------------------------------------------- 143
gi 542201379  100 ------------QP--------------KDQPFN---------------------------------------------- 107
gi 1040662818 263 --------ETVNSP--------------ALTASS---------------------------------------------- 274
gi 768931313  143 --------KGQHSD--------------GKSRKR---------------------------------------------- 154
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 597755038   92 -----Q------------------------------------RTASSSS----SLCNESGSdGSFSSAss---------- 116
gi 410911334  162 -----HiqgagsrsrrsaaitaavkqefhleeekfftedeyvEEEEDDD----DEEEDEAS-SSEKGLkk---------- 221
gi 1041096176 208 hshstP------------------------------------STTAGSGcsksGSVTRSSI-NEMSGHsgpdslsllges 250
gi 565322366  142 -----E------------------------------------SR---NG----EVTDDDSMaSWLTASpeeg-------- 165
gi 94536856   120 -----D------------------------------------SRGGAGG----EASDPESAaSSLSGAseeg-------- 146
gi 512854631  118 -----E------------------------------------GKECCNE----DLTDNDSMlS-VSAYseeg-------- 143
gi 557007817  144 -----------------------------------------------NG----NISDDEDGlGTQSPSsdag-------- 164
gi 542201379  108 -----D------------------------------------PFSLKAS----ENSDSSSAfSSVSSVwsss-------- 134
gi 1040662818 275 -----S------------------------------------TIVTSQK----NQSTDTSSdSSESTDssds-------- 301
gi 768931313  155 -----E------------------------------------RASCSSS----DGS-PSGSeASDSSEasaa-------- 180
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 597755038  117 -------------------------aASERKRRh---KEKKKGKKGKDYGRKRATGVQYVIHRYKQVLSAFNKKKSMSGA 168
gi 410911334  222 ------------------------kgRGRANSEpr-mKMRRIFRITHGRERQRVKDPDGVLIRYKKILTTYQRVRSMSRA 276
gi 1041096176 251 ddyleqdgfieeeeiisgedvmpdtiSTNRHQL----KRRRLFRAP--RERQRVKDAAGVLFRYKKILLTYQRLKNMSKA 324
gi 565322366  166 ----------------------gsveHKKLIAG----LNRRCFAKPKIRERQRVKDVDGVLCRYKKILYTFQKMQSMSRA 219
gi 94536856   147 ----------------------saseRRRQKQKg--gASRRRFGKPKARERQRVKDADGVLCRYKKILGTFQKLKSMSRA 202
gi 512854631  144 ----------------------dtlaDTKRQRQkg-sCNKRGFCKPKIRERQRVKDADGVLCRYKKILSTFQKLKSMSRA 200
gi 557007817  165 ----------------------cselDRKKLRGr--gARGKQPLRVKVRDRQRVKDAEDVLCRYKKILTSFQKLKSMSRA 220
gi 542201379  135 ----------------------ssfpKKRKQKYkkkhSRAKKPKKEQKKLRQHVQTPNDIVQRCKSPLKTFPRTKTMTKA 192
gi 1040662818 302 ----------------------eptaKKKKKGKk---SKRQKKSKTKMIDIKRVRTPEDSINRYNKVLQLVRDGLSKAEA 356
gi 768931313  181 ----------------------ssehRRKKHH-----KEKKRSKKTKDYSRKRATGVQYVIHRYKQVLTAFVKKKNMSEA 233
                         330       340       350       360       370       380       390
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 597755038  169 FRHHGIDRNTIANTAPIAELHLAAKEAVPLVGQFRPREETLVNYAQRCALAIetDEELSRKIEQMKANGELLPISA 244
gi 410911334  277 FQIHGVDRNTMASTSPIAELLLVAPEKMTEVGEFEASREKLLDYARRCYKTM--DEQTHTKVQAMKKTHKLLPISY 350
gi 1041096176 325 FQIHGVDRNTVASTTPIAELLLVAPEKVAEVGEFDPSKEKLLDYARRCYIAL--DEETLSRVQALKKNNLLLPISY 398
gi 565322366  220 FEHHRVDRNTVALTTPIAELLIVAPEKLAEVGEFDPSKERLLEYSRRCFMAL--DDETLKKVQALKKSKLLLPITY 293
gi 94536856   203 FEHHRVDRNTVALTTPIAELLIVAPEKLAEVGEFDPSKERLLEYSRRCFLAL--DDETLKKVQALKKSKLLLPITY 276
gi 512854631  201 FEHHRVDRNTVALSTPIAELLIVAPEKIAEVGEFDPSKERLLEYSRRCFLAL--DEETLEKVQTLKKNKLLLPITY 274
gi 557007817  221 FEYHGVDRNTVALTTPIAELLIVAPEKVAEIGEFDSSKERLLEYSKRCFMAL--DEETLMKVQALKRNKLLLPISY 294
gi 542201379  193 FQKHGLDRNTVVSTSSVGELAIAVPNVYQELLSNRSSGETVLAFAKRCEAAIqgSDEV--KKQNRkyegrwyfasi 266
gi 1040662818 357 YNKVKIDRNTIVKQAPIAELATANPTEFKSLRATFKKGESVQEFANLCLTRClaQSNM-EILKQLKESNALLDIfk 431
gi 768931313  234 FRHLGIDRNTIANTASIAELHLAGVDFVHLVGRFRQGEETLVNYAQRCTMVIdsDSDLSQKIDQMKANGELLPISg 309
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap