Conserved Protein Domain Family
KELK

?
pfam15796: KELK 
KELK-motif containing domain of MRCK Ser/Thr protein kinase
KELK is a domain of eukaryotic proteins found in serine/threonine-protein kinase MRCK-type proteins. The region is low-complexity, but it is not a predicted disordered-binding domain. The name comes from a highly conserved sequence motif within the domain. The function is not known.
Statistics
?
PSSM-Id: 318090
View PSSM: pfam15796
Aligned: 32 rows
Threshold Bit Score: 91.5078
Threshold Setting Gi: 637378379
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 82232919   528 VRNLEKQLKSVTQEKDDLHKELLGLAEKVKAQGKELKDAHSQKKMAIKEFAELNEQLSDVRTQKQRLSRQFKDKEEEME 606
gi 761902469  478 MKTLERAVRSLKSEKNSLTEQVSDLKESLAAKEKELKEGNKRYRESQDELNRISDKMTDYRSQKRELSRALREKEEEYD 556
gi 762153401  520 kiEVERKLRLIDEEKQALEKDLQEFRDKYKLQARELKDAVAKQKIAIEQFTDTNESLLKTQSKVKELTRESRNREEEMD 598
gi 637378379  503 LKALDERVKFLEQEKNEALQELAETQEQLRVQGWELRDEQLRQKELAEELQGAEAKCGELRAQLLRHSRQLRERQEETE 581
gi 512835625  476 FQSLEKEIRSLKQEKESCNKELSDMLERLKSQGVELKAALEKKKTMQEELRGAEEKCESLNSQVGRLTRRLKDKEDEVE 554
gi 939256397  534 IKDLEKSIRMIKQEKEEAVKDKFDFQEKLKMQDKELKDALSQRKLAMAEYSEVTDKMQELRVQKTKLSRQVRDKEEELE 612
gi 795024341  176 FRELEKLVRCLRTEKEEAIKDKLDVQEKLKLQDKELKDALTQRKLAMAEYTEVSDKLSELRQQKQKLSRQVRDKEEELE 254
gi 242024080  534 IKELEKNIKLLNQEKDSMQKDKLDAEEKLKFQDKELKDALSQRKLAMAEYNEVTDRLSELRQQKQKLSRQVRDKEEELE 612
gi 827540905  563 LREMELIVQSLTAEKEELFKERTDSMEKLKLQDKELKDAISQRKLAMAEYNEVTERLSELRQQKQKLSRQVrdkeeele 641
gi 541047867  588 LKELKEKNRQLILDKQDLQRDLEETSERLTIQTRELKEAVKHRDLAKQDYDELNTALLDERDKSKRLEKVAKERESECs 666
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap