Conserved Protein Domain Family
CCD48

?
pfam15799: CCD48 
Coiled-coil domain-containing protein 48
This family of proteins is found in eukaryotes. Proteins in this family are typically between 161 and 575 amino acids in length.
Statistics
?
PSSM-Id: 318093
View PSSM: pfam15799
Aligned: 7 rows
Threshold Bit Score: 737.548
Threshold Setting Gi: 821470439
Created: 30-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 300669630   7 DPYRRPARRTQWLLSALAHHYGLDRGVENEIVVLATGLDQYLQEVFHHLDCRGAGRLPRADFRALCAVLGLNADGEt--- 83
gi 300680884   7 DPYRRPARRTQWLLSALAHHYGLDRGVENEIVVLATGLDQYLQEVFHHLDSRGAGRLPRADFRALCAVLGLRFEGAaap- 85
gi 655833494   7 DPYRRPARRTQWLLSALAHHYGLDRGVENEIVVLATGLDQYLQEVFHHLDCRGAGRLPRADFRALCAVLGLRTEGSpag- 85
gi 821470439  10 DPYRRPARRTQWLVSALAHHYRLDRGVENEIVVLATGLDQYLQEVFHHLDCKGDGRLPGEDFRVLCKVLGLRPG------ 83
gi 390475373  18 DPYRRPARRTQWLLSALAHHYGLDRGVENEIVVLATGLDQYLQEVFHHLDCRGVGRLPRADFRALCAVLGLRAEGTtaa- 96
gi 859747401   7 DPYRRPARRTQWLLSALAHHYGLDRGVENEIVVLATGLDQYLQEVFHHLDCRGAGRLPRADFRALCAVLGLRAEGAaa-- 84
gi 831236712  18 DPYRRPARRTQWLLSALAHHYGLDRGVENEIVVLATGLDQYLQEVFHHLDCRGAGRLPRADFRALCAVLGLRAEGTtaar 97
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 300669630  84 --ATEDANSAEAASTN-----PAAGMIAGGDADVREEARLALRAD-PPELTFRQFHARLCGYFSSRAGP-------RLPR 148
gi 300680884  86 geASEDTAAGDTNSGDvisgdAAAGEAAEWDEDAEEEARLALRAE-PPELTFRQFHARLCGYFGTRAGP-------RLPR 157
gi 655833494  86 seAAEDAAAGGADSGD-----VSAG---EGDADVEEEARLALCAE-PPELTFRQFHARLCGYFGARAGA-------RLPR 149
gi 821470439  84 --ASLDTERG------------------CGEEEEDEEERAALWDDlAPELTFRQFHARLCGYFSTRAGAregpegsRLPV 143
gi 390475373  97 geAAGDANSRDVTAGD-----TAAEVATDRDADTEEEARLALRAE-PPELTFRQFHARLCGYFGTRAGP-------RLPR 163
gi 859747401  85 geASGDAAEGDANPGDetagvAAAGVATDGDADVEEEARLALRAE-PPELTFRQFHARLCGYFGTRAGP-------R--- 153
gi 831236712  98 eaAAEDVNSKNVSTGD-------AAPVTDADSDAEEEARLALHAE-PPELTFRQFHARLCGYFGTRAGP-------RLPR 162
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 300669630 149 GALSEHIETQIRLRRP--RRRRRPGSPSLHGGA------------YGERVAHLEEENSSLRELVEDLRAALQSSDARCLA 214
gi 300680884 158 GALSEHIETQIRLRRPrrRRRRAARPPGPDGGP------------DGERLARLEEENSSLRELVEDLRAALQSSDARCLA 225
gi 655833494 150 GALSEHIETQIRLRRPr-RRRRASREPGPDGGP------------DGERVARLEEENGSLRELVEDLRAALQSSDARCLA 216
gi 821470439 144 GPESEHIE-----------------TAGSAGCSrecyeevvaleqAEDRVAKLEEENASLRELVEDMRAALQSSDARCLA 206
gi 390475373 164 GALSEHIETQIRLRRPr-RRRRPPCVPGPDSSP------------DCERVARLEEENSSLRELVEDLRAALQSSDARCLA 230
gi 859747401 154 ---------------------------------------------DGELLARLEEENSSLRELVEDLRAALQSSDARCLA 188
gi 831236712 163 GALSEHIETQIRLRRPr-RRRRLPRVPGPDGGPdg--------gsDDERVARLEEENSSLRELVEDLRAALQSSDARCLA 233
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 300669630 215 LQVGLWKSQSDI-------------------------------------------------PEAAA-HELQRAQGALAEA 244
gi 300680884 226 LQVGLWKSQAGAqeaa------------------------------------------rgePEAAA-RELRQARGALAAA 262
gi 655833494 217 LQVGLWKSQAGGheeg------------------------------------------lggPEAAAeRELRQARGALAAA 254
gi 821470439 207 LQVGLWKSHASHkqdsscfpgprmlsthgtppptkgfqsvlkeaelirssrdgqieeaiqanQELA-KELRQCQEALAAS 285
gi 390475373 231 LQVGLWKSQASIhetg------------------------------------------rggPEAAA-RELRQAQGALAAA 267
gi 859747401 189 LQVGLWKSQAGAqeag------------------------------------------rggPEAAA-QELRQARGALAVA 225
gi 831236712 234 LQLRSLHRVRELe------------------------------------------------------------------- 246
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 300669630 245 EARARRLQRGQVEVRLRTEEARQAVRRSLHR-VRELEALARRVPCLQRQVQRLEAELRGYRSEGPQLLTPQQASPRP--- 320
gi 300680884 263 EAQAGRLRRGQAEVRRRAEEARAAVLRSLGR-VRELEALARQMPGLQRGLRLLEGELRRYRSEGTQLPGPSRASPEP--- 338
gi 655833494 255 EARAGRLRQGQAEVRRRAEEARQAVLRSLRR-VRELEALAQQVPGLRRWVQQLEAELQRYRSEGPQLPTPPRASPEP--- 330
gi 821470439 286 EDCNRHLKKEQADMRKKVEEARQAVLSGLGK-VRELEAQATQVLHLQMCVQQLELELQCYRSEIRKLPTPL--NDQKmpq 362
gi 390475373 268 EARAGRLRRGQAEVRRRAEEAREVVLRSLHR-VRELEALARQVPSLQRWVRQLEAELQRYRSEDSQLPSLQRASPEP--- 343
gi 859747401 226 EARAARLRQGQAEVRRRAEEAREAVLRSLGR-VRELEALARQVPGLQRWVRRLEGELRRYRSEGTQLPISSQASPEP--- 301
gi 831236712 247 -----------AQAR---------QVPSLQRwVRRLEAE-----------------LRRYRSGGSQLPTLTRASPEP--- 286
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 300669630 321 ------GNRNGEPTAGGTRDSD--TTPEGVQRSD------SRD---------TDEedeQLFRSVEGQAASE--------- 368
gi 300680884 339 ------DTKSSEPEDGEARGPE--PPPEGAWGSGns--paSRPpgparaspgLDE---QLFRSVEGQAASDe-------- 397
gi 655833494 331 ------GDRNDNFEDGGTRDVD--AAPRGAWSSDss--sgSRA---------LDEvgeQLFRSVEGQAASDeee----ee 387
gi 821470439 363 edgeseSRRAFFPGQ-----PDgiSPSEGAGAAEdg--igCRY---------ADEgdeQLFRSVEGQAASD--------- 417
gi 390475373 344 ------GDKSNEPEDAGTRDTD--PTPEGAWQSDss--sgSRA---------LDEadeQLFRSVEGQAASDkeeeevdee 404
gi 859747401 302 ------EVKRGDPPDNGTRSPD--SPPEGAWQSDsgsgsgSRP---------LDEvdgQLFRSVEGQAASDe-------e 357
gi 831236712 287 ------GDKSGKPEDIGTRDPD--PTAEGAWQSDss--cgSRA---------LDEvdeQLFRSVEGQAASD--------- 338
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 300669630 369 EEEEERWQEKpGRPqAHGEVPLVQPSGCVSRCDDQTAETLKASFGHCDGAEHICTL-ELETHVTRLGEQL--------QT 439
gi 300680884 398 EDDREKWQEAqRLP-AEVTALLAGLSGCGSGCDDQTAKKLMTYCSHLGGANHAHTLgELETCVAMLVEQLgsrg-cgaKT 475
gi 655833494 388 EEEEEKWREMqRPPaAE--ALLARPSSCGSGCDDWTAKKLTTYCSHLGTADRTCTPgELEAHVA----RPgtqg-cggKA 460
gi 821470439 418 -EEEETWPREqQTQaAEVRKLLARISSCGNGCDDKTAKKLMSYFGHFGSDEHTSALgELGEQIVTLTEQLgnmgqdvkEP 496
gi 390475373 405 EEEKKKWQEEqRTPaAEVKSLLARLSGCGGRCDDQTAEKLMTYFGHFGGPDHTRTLgELEACVAMLVEQLgtqg-cggRT 483
gi 859747401 358 EEGEEKWQKE-RSSlAEVKTLLEYLSSCRSGCDDQTAKKLKTYFSHIGSGDDACTLgQLETHITMLVEHLgtqs-crgKA 435
gi 831236712 339 EEEEEEWQEEqRPP-AEAKPLLAQLSGCRSGCDDQTAKRLLTCFGHFGGADHTHALgELEARVAMLVKQLgtqgcsggKT 417
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 300669630 440 LGTPEEE-----AELQQMV-EAEHLRLELQMVETERVRLSLLEEKLVDVLQLLQRLRDLNISKRALGKMLLNALD--RNP 511
gi 300680884 476 LRTPEEE-----AELQRKVgENESLRQELQMVEAERVRLSLLEEKLEDVLGLLQRLRDLNISKKALGKILLSTLDacRDP 550
gi 655833494 461 LGTPREE-----AELQRRAeESEHLRLELQMVETERVRLALLEEKLVDVLQLLQRLRDLNISKRALGKTLLSALDacRDP 535
gi 821470439 497 DTGDQEVkeplfSEIQQKAeESELLKMELQMLETERVRLSLVEEKLMDVLQLLQRLRDLNISKRVLGKMLLNTLEscQDP 576
gi 390475373 484 LGTSGEE-----AELQQKVeENEHLRLELQMVETERVRLSLLEEKLVDVLQLLQRLRDLNISKRALGKILLGTLDafRDP 558
gi 859747401 436 LGTLGEE-----AELQQKVeEIEHLRLELQMVETERVRLSLLEEKLMDVLQLLKRLRDLNISKRALGKILLNTLDacKDT 510
gi 831236712 418 LGTLGEE-----AELQQKVeENEHLRLELQMVETERVRLSLLEEKLVDVLQLLQRLRALNISKRALGKILLSTLDtcRD- 491
                        650       660       670       680
                 ....*....|....*....|....*....|....*....|....*...
gi 300669630 512 SQ--EGTCGTLAILDTLHQALVGCELLQRNPSAPASTAPAHTNPFLIS 557
gi 300680884 551 AH--DGPSGPLAVLEALHRALAGCELLRREPSAPASTAPALPHSFPIS 596
gi 655833494 536 AQ--EGRSGPSATLDALHQALASCQLLRRQSPAPAPATPVLPNPLLIS 581
gi 821470439 577 QHe---KAHTFEVLDALYRTLASCELLQKQPLEQAQAPQALTNQLIIS 621
gi 390475373 559 TH--EGRPRPAAVLDALHQALAACELLRRQPSAPASSAAALTNPLLVS 604
gi 859747401 511 PP--EGRCGPLAILDALRQALAGCELLQGELSAPASTAPALANPLLIS 556
gi 831236712 492 -QgrRGSSGPLAILNALHGALAGCELLQGQPSELTSEAPALTSPLLIS 538
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap