Conserved Protein Domain Family
DCAF17

?
pfam15802: DCAF17 
DDB1- and CUL4-associated factor 17
DCAF17, DDB1- and CUL4-associated factor 17, is a family of proteins found in eukaryotes. It may function as a substrate-receptor for CUL4-DDB1 E3 ubiquitin-protein ligase complex. Mutations in the human protein, otherwise known as C2orf37, are responsible for Woodhouse-Sakati Syndrome. Woodhouse-Sakati Syndrome is a rare autosomal recessive multi-systemic disorder characterized by hypogonadism, alopecia, diabetes mellitus, mental retardation, and extrapyramidal syndrome.
Statistics
?
PSSM-Id: 318096
View PSSM: pfam15802
Aligned: 15 rows
Threshold Bit Score: 180.624
Threshold Setting Gi: 761913547
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221271926  44 SNLKILRNIILKDDTEFVKVWSKTSKSLISYE-SGRIYFDNYRCCYSS--LLPEPELLYELPRTPKTEKIEDALLCQCPL 120
gi 847167130  54 TNLDIIRKLVCQKNTVFRRVWTKHSKLAINYA-KGRIYFDNFRCCFNS--ATPVPQQMYEMPRCSKLEKIEDALLCECPL 130
gi 557000593  30 KNLKILKHLVCQDTTSLRNVWMKQSKSPVVYE-RGRIYFDNYQCCFSC--ANSSPKLLYKMPKCSKMEKIEDALLSECPV 106
gi 156405515  24 KDLKLLRLLVEKRSTKFKNVWSKKSKDPIGFD-CGHLFLDKFRTSFST---NGKPKELYRMQPLRSSEKVESAVVFESPL 99
gi 941779326  32 FCLKILRSITLHENRSFIKVWSKTSKTAIMYD-SGRIYFDNYQNCYSC--VHDQPQNLYKFPKKSKQQKIEDALLCQSPL 108
gi 971405700  38 KNMGLLRTILCQESTKFKNVWTTHSASPIAYE-RGRIYLDNYRCCISS--IAQEPRILYQKPKCSESEKIEDALLLECPL 114
gi 637344306  47 KNMGILRKLICQESTTFRNVWTKHSTSPITYQ-SGKIYLENYRYCLSS--ITPEPRIIYQMPACPKSEKIEDVLLLECPV 123
gi 114581676  31 TNLGILRALVCQESTKFKNVWTTHSRSPIAYE-RGRIYFDNYRRCVSS--VASEPRKLYEMPKCSKSEKIEDALLWECPV 107
gi 761913547  30 itsKIVHNVILEPTVSFENVWHKTSRYPICIGlDRRIYFNNHTEGYfndgpgGEPRRLFHFPPIRQEERHCGALLYFCHI 109
gi 410896958  32 HNMKVFRNLLFQDNRSFIKVWSRSSKSTIMYE-SGKIYFENYLNCYSC--VHSVPQVLYKLPQRSKLEKFEDALLCQSPL 108
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221271926 121 EN----VLPNASEQKSCLLTLTANNWLYLLSADTGETLQRVYLS-SRFKFsRSLGWDSSQETFYVKSVQCKQTALERQ-A 194
gi 847167130 131 GE----SLPHPSDYTPSLLAVTGQNWLLRISADTGEILEKIYLG-SYRKF-RYINWDVPQETLVLKSIQTKSATVSQEdE 204
gi 557000593 107 GE----LLPSLLDYKSSLITVTANNWLFRVSVNTGEVLEKVFLS-SLYRF-RYVTWDVPQESLVVKSAQNRQRAMVAQ-E 179
gi 156405515 100 DQqsfvSTVETKGFKSCVIGVTANGFLFRQDVDTGKRLQTVFLS-RTIKF-KNIFWESDLTRLVIKSVHSK--PLPRViS 175
gi 941779326 109 DK----TLSSPSEHKPCLLALTADNWLCRISAETGKELQRIYLS-PKYKY-RYLAWNVPQETFYIKSVQNKETPLARQ-A 181
gi 971405700 115 GE----MLPNPSDYKPSLIVLTVQNWLLRLSADCGEILEKVYLAgSCCKF-RYLSWDTPQEVMVVKSAQNKLPAEARQ-A 188
gi 637344306 124 GE----VLPNPSDYKPSLVVLTAHNWLLRLSATTGEILEKVYLA-AHCKF-RYLSWDTPQDVMVVKSIQQKHPGAARQ-A 196
gi 114581676 108 GD----ILPNSSDYKSSLIALTAHNWLLRISATTGKILEKIYLA-AYCKF-RYLSWDTPQEVIAVKSAQNRGSAVARQ-A 180
gi 761913547 110 RD----KPLFEEEKEVCLMILTYDGFLKILNADTRKVLRSVYLS-TAVPFryfncewaylsllm---------------- 168
gi 410896958 109 GD----VLSNPSDHKPSLLALTANGWLYRLSAETGEELQKVYLS-PNIKF-RYLGWDVSQETVYIKSVQNKETSLERQ-A 181
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221271926 195 GVD---NNILMRVAAFQVFPLQLVGMLEINKKVFGKTAVDVLLSQGVLAVSHSSKLVRLYSFEYIVNKFRTEELILGQQC 271
gi 847167130 205 GNT---RAVLFYLAVFSVFPLSLVGILEITKHIFGSTVTDAMISHGMLIVMHSVGLVRLYSFERITEQFMKQKHVVGQVC 281
gi 557000593 180 --------------------------------VFGNHVIDATISHGILIVMYRMGLVRLYNFQWITETYTSKKVMLGQKC 227
gi 156405515 176 GNNphvNNVLLHLALFDVAPLKFVALIPIERSLFGSTITDATSSMGILFVMHRSGLIQLYSTQEIIDKY-SQITDLGKPY 254
gi 941779326 182 GIS---QNVVMHMAIFHVFPLQIVGILEINKKGFGSGVTDVVLSQGVLAVSYSNKSVKLYSFEHVVQRCLIEELTLGQQS 258
gi 971405700 189 GIQ---QSVLFHLAVFQVLPLSFIGMLEINKKIFGNSVTDVAISNGILIVMYSMGLVRLYNFQAISEKFMERPFDLGSEL 265
gi 637344306 197 GVQ---QSVLFVLAVFRVLPLSFIGMLELDKKFFGNSMTDASMSDSMLIVTHSTGLVRLYSFQTISEQFMLQRVDLGQEY 273
gi 114581676 181 GIQ---QHVLLYLAVFRVLPFSLVGILEINKKIFGN-VTDATLSHGILIVMYSSGLVRLYSFQTIAEQFMQQKLDLGCAC 256
gi 761913547     --------------------------------------------------------------------------------
gi 410896958 182 GIT---QNTVMHLAIFHVFPLQIVGILEINKRVFGNGVTDVVVSQGAIVVSYSNKSVKLYSFEHILQRHLTERLILGKQS 258
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221271926 272 ELN----------------NARGIVGDAPYGVPVNICIHECPPVLFEMTYFENGVQIGGHPWHYIYTPNHKRHRGTHHVC 335
gi 847167130 282 SWK----------------GETGTIGDFPFGIPCNIKPTESLPFLFEVSCLENAFQVGGHPWHYIITPNKKKEKGTYHIR 345
gi 557000593 228 QWN----------------GTTGIVGDTPFGIPCNITVTDTPPLLFEVPCLENAFQIGGYPWHYIITPNKKKQKGTYHIC 291
gi 156405515 255 TINtsacsnptseyhanniDGTGIVGSHPFGIPVNVHMVSKPTLLLEVSSHQHSLSFGGFPWHFVVSPP--RQSSVFHVY 332
gi 941779326 259 PLL----------------GHR-TVGDVPFGIPVNIQITEPPPLLFEAF-SHNGIQIGGFPWHYIYTPPHKKHRGTHYIS 320
gi 971405700 266 NWN----------------GEVGVVGKYPFGLPCNIKITDTPPLLFEASSLENAFQIGGFPWHYIITPNKKKHRGVFYIC 329
gi 637344306 274 NWN----------------GKIGIVGKYPFGIPYNIKITGAPDLLFEVSSLESTFQIGGFPWHYIITPNKKSQKGIFHVC 337
gi 114581676 257 RWG----------------GTTGTVGEAPFGIPCNIKITDMPPLLFEVSSLENAFQIGGHPWHYIITPNKKKQKGVFHIC 320
gi 761913547     --------------------------------------------------------------------------------
gi 410896958 259 SLL----------------EGK-TVGDFPFGIPRNIHItDCPPLLFEVLCSNNSVQIGGYPWHFIYTPPQKNHRGTHHVC 321
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221271926 336 SITDGALAKNGVQDMKCDSLEVDWIFFHPDDSGRIIHAGPSTINILKIMAETGCDWKYEIITD-FSITA--ARDSNA--S 410
gi 847167130 346 SLDDHSLAKNGIRDMSCCSLEPDWIHFHPDASERIIHVGPDQIRVLRLKELQNDSYRHQVCED-FAILA--TRDKEVn-K 421
gi 557000593 292 SLENNTLAENGIQDMKCCSLECDWIYFHPDDSGRVVHVGPNQINVLRLKETPETDHQHQVTED-FVILA--KREAKLl-H 367
gi 156405515 333 SIKEKELVGNGIIKSDVLSVEPDQAYFHADHSGRLLHICPHSIRFLKLKTLGDLGVGQLVLDTcFSISTrdNQSNRSt-K 411
gi 941779326 321 ALKDSTLAKNGIQNMNCCSLESDVIFFHPADSGRVIHIGPNTINVLKVISELNSPLPSEVLED-YSLTT--HR-SHPs-P 395
gi 971405700 330 SLKDNALAKNGIQDMKCCSLEPDWIYFHPDMSGRIIHVGPNLIKVLKLKEVENNTDQIEIAED-FIITA--NRENCVn-N 405
gi 637344306 338 SLKDHTLAKNGVQEMKCCSLEPDWITFHPDSSGRILHVGPNLIKVLKLKEVEGNTELQKVTED-FIIQA--SRENNIe-N 413
gi 114581676 321 ALKDNSLAKNGIQEMDCCSLESDWIYFHPDASGRIIHVGPNQVKVLKLTEIENNSSQHQISED-FVILA--NRENNKneN 397
gi 761913547     --------------------------------------------------------------------------------
gi 410896958 322 SLKDCSLAINGVQSMSCNSLESDAMSFHPDDSGRMIHVGPTIINVLKLVSDLNNDMQSRVVKD-FSMAT--HRSSNPt-Q 397
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221271926 411 -QVIVTSSGRTVKRRFQMLDDDPAQETFRMVKYEDELDLLAVVdIT-HAEDEGQARLRLHDNKTGALMKRVPLEEPWDVT 488
gi 847167130 422 -PVTVTASGRLVKKRFAQLDDDPEQETFKIVVYEDELDLLTVV-AVtQTEAEGKAHVALHCNDTGKLLKNIVLLESWDVT 499
gi 557000593 368 -SVTVTASGRVVKKRFEQLDDEPEQETFKIVDYEDELDLLAVV-AVtQTESEGRAHIDLYNNQTGTLVKTVPLVEYWDVT 445
gi 156405515 412 gQTSYTSSGRLVKCVSSDGYHDPEYDSIQDLDYEDELDLVAVL----SSRDCSSGYIGLYDNQTGVLVKEITL-DNWDDE 486
gi 941779326 396 -RVTVTSSGRTVRSRFQQLDDDPMQETFRLLEYEDELDLLAIA-VTnGEGEEGRAHVQLHDNQTGRLQRKIDLDEPWDET 473
gi 971405700 406 -SVTVTSSGRVVKKRINLLDDDPEQETFKIVDYEDELDLLSTVaVT-EIGADGRAHLDLRCNEHGILLKSIPLRESWDVT 483
gi 637344306 414 -SITVTSSGRIVKNRFNSLDDDPEKETFQIVDYEDELNLLSIAaVT-QIGSDGSARLDLRCNERGTRLKSIPFVESWDVT 491
gi 114581676 398 -VLTVTASGRVVKKSFNLLDDDPEQETFKIVDYEDELDLLSVVaVT-QIDAEGKAHLDFHCNEYGTLLKSIPLVESWDVT 475
gi 761913547     --------------------------------------------------------------------------------
gi 410896958 398 -QVTVTSSGRTVKRRFHQLDDDPDQETFRMVEYEDELDLLAAV-VTdGNEGEGRAHIQLYDNQSGQLLRNVALSESWDET 475
                        490       500       510
                 ....*....|....*....|....*....|
gi 221271926 489 YSHEVYFDRDTIIHTVQEKNNSFCCHVYKM 518
gi 847167130 500 HSHAVFFDRDTLIHIEERPNRNFSCYVYKM 529
gi 557000593 446 YSHRIFFDRETVVHIEQKPNRIFCCYVYKM 475
gi 156405515 487 SEHSIMMERDLIVHICRTPFKKFSCTLYRL 516
gi 941779326 474 YPHELFFDRDTIVHIEQ-KGSQFCCYVYKL 502
gi 971405700 484 YSHEVYFDRDIVLHIEQKPNRKFSCYVYQM 513
gi 637344306 492 YSHEVYFDRNVVLHIEQKPNRTFSCYVYHM 521
gi 114581676 476 YSHEVYFDRDLVLHIEQKPNRVFSCYVYQM 505
gi 761913547     ------------------------------
gi 410896958 476 FPHELFLDKDTIVHIEQ-KNSTFWCHVYKL 504
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap