Conserved Protein Domain Family
MAP17

?
pfam15807: MAP17 
Membrane-associated protein 117 kDa, PDZK1-interacting protein 1
MAP17 is a family of proteins found in eukaryotes. It is a small non-glycosylated two-pass membrane protein, that is overexpressed in many tumors of different origins, including carcinomas.
Statistics
?
PSSM-Id: 318101
View PSSM: pfam15807
Aligned: 17 rows
Threshold Bit Score: 80.5633
Threshold Setting Gi: 513008851
Created: 30-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 172046059   6 ALLVLEFLLLSPVEAQQATEH--RLKP-WLVGLAAVVGFLFIVYLVLLANRLWCSKARAEDEEeTTFRMESNLYQDQSED 82
gi 637330459  71 IVILCFLVILEPANCQIATGP---LQP-WMRGTIAVSVFLVLACVAFVINRIWCQN---KHDSsERRNMGVNKEEEVISN 143
gi 334321566   6 LVLLCLLIVAEPVTCQQGLGK---LEP-WMQGLIAVAVFLALVAIAFAVNRFWCQE---EPEPvTTVMSIGGKSDGNLA- 77
gi 5031657     6 LLILGLLTAVPPASCQQGLGN---LQP-WMQGLIAVAVFLVLVAIAFAVNHFWCQE---EPEPaHMILTVGNKADGVLV- 77
gi 823464944   6 LLLLGLLLQLPAAFCQEARGS---LQP-WSQGVIAVVVFLVLVAIAFVVNRFWCKD---KVENaENVVSVEDKPDAVTSN 78
gi 733901513   6 LLALGLLLALEPASCQEARGK---LQP-WSQGVIAVVVFLVLVAICFVVNRFWCKK---QQDNvETVVSIGAKEEAVVPN 78
gi 847120019  19 qhLLLILFSLGQVSAQHVHNNvgRRFPqWLTGLIAMTVFLFLVLVVYVAKMLWKKR--------SQQGTNMKDFEEVVAN 90
gi 293348470   6 RLLLLATLFLTPAEAQQASER--RLKP-WLVGLAAVVGFLFIVFILMLVNRVWCSKDRAEDEE-ATFRMDHIVNQNSKPS 81
gi 354488671   6 RLLLLAALLLAPAEAQQASER--RLKP-WLVGLAAVVGFLFIVFVLMLANRVWCSKPRPDDEE-VTFRMEANV--NVEPS 79
gi 675756593  12 SLLVLEFLLLSPAEAQQTTER--HLKP-WLVGLAAVVGFLFIVYVVLLANRVWCSKARAEEEE-AMFRMEPNLYQDLSED 87
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*....
gi 172046059  83 KREKKeakekeekrKKEKKTAKEGESNLGLDl--eEKEPGDHERAKSTV 129
gi 637330459 144 GTEGRy-----------SATASNFRCEEGPHv--yENEVELEcesttah 179
gi 334321566  78 GVDGRy-----------SSMALSFRSNEHKNayenENVMEDIPRVRSTP 115
gi 5031657    78 GTDGRy-----------SSMAASFRSSEHENa--yENVPEEEGKVRSTP 113
gi 823464944  79 GHEGRy-----------VSAAADFRSKENEHa--yENTVEPEEKVITTA 114
gi 733901513  79 GREGTy-----------VTSAVDFRSKENKHa--yENTLDPEEKVITTA 114
gi 847120019  91 GTGGCyetri-----------eniwSGENIHa--yENPIEVNDNVRTTA 126
gi 293348470  82 KADKK----------KQKVGRKGGQSNEGLDl---EEEFSDDERDkkta 117
gi 354488671  80 KTEKKkk-----kkQKKQVDRKGGHSNEGLDl--gEKDSSDDERDKKTA 121
gi 675756593  88 KREKKhaqgkeeerKEEKKAAKEGESNLGLEl--eEKEPQDHERAKNTA 134
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap