Conserved Protein Domain Family
BCOR

?
pfam15808: BCOR 
BCL-6 co-repressor, non-ankyrin-repeat region
BCOR is a domain family found in eukaryotes, and is approximately 220 amino acids in length. This domain lies just upstream of the ankyrin-repeat region at the C-terminus of BCL-6 co-repressor proteins. The function of this region is not known.
Statistics
?
PSSM-Id: 318102
View PSSM: pfam15808
Aligned: 9 rows
Threshold Bit Score: 103.06
Threshold Setting Gi: 542253841
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82204524   1195 GLRLSKPRHLHNLQELWDRQGqlnhdrpqfgatnlglPPT---SkasIPPLQTTRREKLDPCTPEvprvahgVPAvdrKV 1271
gi 395854955  1207 GLHPKKQRHLLHLRERWEQQV----------------SAA---D---SKPGRQSRKEVTQAVQPE-------ATT---QG 1254
gi 556975320  1217 GLHPKKQRHLQHLRELWEQQV----------------LPEratS---CKPIRHSRKDLAEDWQPE-------VTTkerKV 1270
gi 431915003  1129 GLHPKKQRHL-HRREQSKQQR----------------SAT---E---NKPSWKGRKEMTQAVWPE-------VTSr---d 1175
gi 542253841  1401 hqssiinsrlkrgreedreeemeveegtenlskkakftneasledvkklkvcielnglrlnkprlpgefnqwlptgqrsa 1480
gi 973192328  1269 GLRLRKQRPLQELRQLWEQQVspq----------rsvLAA---ApppPPPPPHGRKDPAEPCPPE-------VTArdrKV 1328
gi 126325303  1180 GLHPKKQRHLQHLRELWEQQVs---------------PPE---RsppSKLGRQSRKDLAEAVQPE-------VTA---KV 1231
gi 1040236642 1206 GLHPKKQRHLLHLRERWEQQVs---------------AAE-------NKGARQSRKEVTQALPSE-------VTI---QG 1253
gi 395854957  1155 GLHPKKQRHLLHLRERWEQQVs---------------AAD-------SKPGRQSRKEVTQAVQPE-------ATT---QG 1202
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82204524   1272 KtNGIEEKGL--KRKA--EVERGWTKEQLEYAESNTAIPALSDsfcSDSIRKFSSAV------------PPHHLSDKRQR 1335
gi 395854955  1255 N-NITEEKPG--RKRAeaKTNRSWSEESLKSSDNEQGLPVFSG---SPPMKSLSSTNvsgkkqtqpsctPASRPSAKQQK 1328
gi 556975320  1271 K-DWAEEKHT--RKRSevKSSRSWSEESLGRSDIGQGLLTPLS---SPHQKNLSASTenvkkqtesnstPASKAAAKRQK 1344
gi 431915003  1176 N-NISKDRQGqdRTRAeaKGNRSWLEDSLTSGENEQGFSVFSS---SLSMKTLSSASarskegaqpnyiSAFSLHTEHQK 1251
gi 542253841  1481 eanrkfrtdvpsirarsdisegwceptfmrrdgtrvfhmaphpsspthlprqpsssvnrqptptsfatftsfhLQDKHQK 1560
gi 973192328  1329 KgSLVEEKPT--KKRSegKVNRSWSEEPLCKSDIEQGLPVPPVt--SPHADCLDSPPpdaavsrkpplaAATRLSDKRQR 1404
gi 126325303  1232 K-DCTEEKHP--RKRSevKSNRSWSEESLRTSDNVQGLPVFPV---SPHMKSLSSTNangkrqtqpsctPASRLAAKQQK 1305
gi 1040236642 1254 N-DISEEKAS--RKRTeaKGNRSWSEESLKSSDNEQGLPAFSS---SLPRTSLSSTNasgkkqtqpsctPASRLPARQPR 1327
gi 395854957  1203 N-NITEEKPG--RKRAeaKTNRSWSEESLKSSDNEQGLPVFSG---SPPMKSLSSTNvsgkkqtqpsctPASRPSAKQQK 1276
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82204524   1336 LKEHRKSv----------GSSSPSPDPDCTFPGRLRRHGD-PEKPKGKRQCKTKHLSQQERRMLLQSTNQecPELSPAHQ 1404
gi 395854955  1329 IKESQKT-----------DVLCTDEEEDCQAASLLQKYTDnSEKPSGKRLCKTKHLIPQEPRRGLSMTGD--YYVENADG 1395
gi 556975320  1345 TKERRAT-----------DTTCTDEEEDFATTLTLPKCTE-HEKPPGKRQCKTKHLTRQERRR-SSLTGDdaTDIESSEE 1411
gi 431915003  1252 IKESQNT-----------DILCTNDKYDSQAASPLQQYTDnSEKPSGKRLRKTKHLIPQEPRQGLLMRN---YCIKNADG 1317
gi 542253841  1561 LKENRKVsnflpslpslpPSFSSSPDPHPF-----RCPDDdPDKPKGKRPCKTKHTGGEAAKEEGQDEGG--SDEEERNG 1633
gi 973192328  1405 LKEHRKAsg--------lGPPSPGSGKDAETTPWLRRHSD-LEKPKGKRQCKTKHISLRDRRRASQTAEEsaDLESPVEQ 1475
gi 126325303  1306 IKESRKT-----------DVLCTDEEEDFQPASLLQKYTD-CEKPSGKRQCKTKHLTPQERRRRSSLTGDdtTDIENNED 1373
gi 1040236642 1328 LKESPKP-----------DVLCTDEDEGCPAASLLQKYPDhSEKPSGKRLCKTKHLISQEPRRGLALPGD--YYVDNADG 1394
gi 395854957  1277 IKESQKT-----------DVLCTDEEEDCQAASLLQKYTDnSEKPSGKRLCKTKHLIPQEPRRGLSMTGD--YYVENADG 1343
                          250       260
                   ....*....|....*....|....*
gi 82204524   1405 HKVVkCSAQKRPALLSNYESSPIKP 1429
gi 395854955  1396 KMTV-RRFRKRPESSSDYDLSPAKQ 1419
gi 556975320  1412 KVTTaRRFRRLLVPILDSDSSPTKP 1436
gi 431915003  1318 KVTM-QRLRKQPEPSFDCDLSPVKQ 1341
gi 542253841  1634 KVALsDS-SRSPthrppspqhthnt 1657
gi 973192328  1476 KVSLkRSTRKRSASVSDYESSPVKS 1500
gi 126325303  1374 KVMVtRRFRKRPEPASECDSLPSKL 1398
gi 1040236642 1395 KMTV-RRVRKRPEPSPDYDASPPAK 1418
gi 395854957  1344 KMTV-RRFRKRPESSSDYDLSPAKQ 1367
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap