Conserved Protein Domain Family
STG

?
pfam15809: STG 
Simian taste bud-specific gene product family
STG was first isolated from rhesus monkey taste buds. The exact function of STG is not known, but it has been implicated in follicular lymphomas, though not with psoriasis at least in a Swedish population despite lying close to the PSOR1 gene-locus.
Statistics
?
PSSM-Id: 318103
View PSSM: pfam15809
Aligned: 10 rows
Threshold Bit Score: 257.083
Threshold Setting Gi: 351713122
Created: 30-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122134891  40 LGTNLPQLGQPSSTGPSNSEHPQPALDPRSNDLARVPLKLSAPPSDGFPPAGGSAVQRWPPSWGlPAMDSWPPEDPWQ-M 118
gi 532112878  40 LGTNLPLLGQPSFTGPTNYGHPQPKPNSGSNDLEGVPLKPNVPPPDGSQPAGGSGVRRWPPSWG-PPLGFWPSEDPWQ-M 117
gi 545518452  86 VGANLPLLEQPYLTSHSNSELPQSKPDPGPNDLTRVPLKLNVSPSDGFLPAGGSGVQRWPPTERlPSMDSWPPEDPWQ-M 164
gi 301760114  41 LGTNLPLLEQPSLPSHSNSELPQPKPDPGPNDLTRAPLKPNASPSDGFQPAGGSGVQSWPAMEGlPSMDFWPSEDPWQ-M 119
gi 545198688  46 LGTNSPLLGQPFLASLSNSEHPQSKPDPGSNDLARAPLKTNASPSDSFQPAGSSEVQRWPPSEElPSMDSWPSEDLWP-M 124
gi 291395743  40 llTNLPLLGQPPLTGPSNSGHPQFT---GADPLRLPPL------SDDFLLAGGSAVQKWPPSWGl---QSWSSEEPWQmM 107
gi 351713122  42 wGTDLPVPGQPPFTGRANAGRPQPSVDPGPDDVVGRPSKFSA-PPGGPPAAGRAGRQMWPPSWGlPPAESWHPEAPWP-M 119
gi 296197642  44 LGTSLPRVGQPSLTGPFNSEHPQPSLDPRSNDLARVPLKLSAPPPDGLSPAGGLGVQRWPPSRGlPAVDSWPPEDPWK-M 122
gi 344307656  40 LGTNLPLLGQPSLARSSDSEHPKPKPDAGSNGLARSPLKPRMSLYDGSQAARGSGVQKWLPPEGlPSVDSWPPEGPWP-V 118
gi 555968153  40 LGISLPLLGPSPLTGPSNAEHPQPKPAPGPNDLARAALKPNPSPPHGSQPVGGPGVQGWPRSGGlLSMDSWPSEDPWP-M 118
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122134891 119 mAAAAEDRLGEALPEELSYLSSAVALAPGSGPLPGESSPDATGLSPEASLLHQDSE-SRRLPRSNSLGAGGKILSQRPPW 197
gi 532112878 118 -DAANEDQLGEMPPEGLPYLSSAGAVPLGGRPLSVASSAHPEEPSSETSLLQKNSE-SGQLPRSNLLGAQRQALSQHPFW 195
gi 545518452 165 mAAAIEDHIGEVLREKQSFLSGAIAPTLGSSFLPAGPSAHSAGPIPEAS-LYQESK-FRQPLHSNVLGAHREILPETxps 242
gi 301760114 120 vAAAIEDHGGEALPEKQSSLSG--ALPRGSSPLPAGSSARSTRPVPEASLLYQDSK-SRRSLHSNVLGAQREILVQQPP- 195
gi 545198688 125 mAGAVEDDGGEVLPEELSFLSNAIALPLDSGLVPAGSSSHSADPSLEVSPLHQDSE-SRPLSRSNVLGDQKQILAQRPPW 203
gi 291395743 108 mGAAAEGQAGQVLPQGPSYLSSAGALPLGRGSWPAQSSAHSLLPAADSFLLHQDLEpAGQLPLLKWLGAQREALAQRPFW 187
gi 351713122 120 vARAAEEHLEQALPEELAYLSSAGAPALYSGSLLAALSGKAAQPSPEALPDPQGLE-ARWLTLVSQLGAQGELLAQRPFW 198
gi 296197642 123 mAAVAEDHLGGVMPEELSYLSNAAALPPGSDPLPGESSADPTDPSSKALVLYHDLE-SRRLPPSNPLGARGKILSQHPFW 201
gi 344307656 119 mAAAVEDHPGDLLPEGLSYLASAVALPLGSGLLPEGSSAHFAGVPPDASLLHQDPE-LRRPPHPSPLGAQGEIPVLRPLC 197
gi 555968153 119 lAAAVEDHVGEVLPGELSYLSRVAALPVGSRPWPAGPSAHPGDPSPESSLFHRDSE-SRRPFRPNVLGSLGDILARSPLW 197
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122134891 198 SLIHRV----LPDHPWGTLNPSVSWGGGGPGTGWGTRPMPHPEGI-WGINNQPPGTSWGNINRYPGGSWGNINRY----- 267
gi 532112878 196 SLIHRL----LPGIPWGTLSPGVSWGGGGPGTGWGTRPIARPPGT-WGIHNQFPGSIWGNINRYPGSIWGNINRY----- 265
gi 545518452 243 l-tnrIrqppMPGHPWGTLNPGVSWGSGGPGTGWGTRLMPHSVGI-WGINNRYPSTSWGDINRYPGTSWGNVNRY----- 315
gi 301760114 196 SLTNRIrqplLPGHPWGTLNPGMSWGGGGPGTGWGTRPMPHPLGI-WGINNQNPSTSWGDINRYPGCSWRDINRY----- 269
gi 545198688 204 SLISRIrkplLPGHPWGTLNPSVSWGGGGRGTGWGTRPMPCPVGI-WG-NNKCPSTSWGNINQYPGGSWGSINRY----- 276
gi 291395743 188 SLLHRL----LAGTPWGALSPAVSWGGGGSGTGWGTRPMSHPAGI-WGLNNQFPGTSWGNIYQYPASSWGSVNRY----- 257
gi 351713122 199 SLIYRL----LPGLPWGALNPSVPWGGGALGTGWGTRPMPYP----WGSHNRFPGNSWGNINRYPGNSWGDNSRD----- 265
gi 296197642 202 SLIHRL----LPGHPWGTLNPSVSWGGGGPGTGWGMRPMPYPGGI-WGINNQPPGTSWGNTNRYPGGSWGNMNRY----- 271
gi 344307656 198 ALINRIrqslLPSHPWGTLNPCVSWGGGRPGTGWGTKPMPPSHAGsWGINNQFPGSSWGNSNRYPGGSWGNSNQY----- 272
gi 555968153 198 ALINRIrrplLPGHPWGTLNPSTSWGGGGPGSGWGTRPMPYPVGI-WGNTHQYPSTSWGNIPLYPG-----INQFppril 271

                 ....*....
gi 122134891 268 --PGDSWGN 274
gi 532112878 266 --PGTSWGN 272
gi 545518452 316 --PGGSWGN 322
gi 301760114 270 --PGGSWGD 276
gi 545198688 277 --PGGSWGS 283
gi 291395743 258 --PGGSWGN 264
gi 351713122 266 --PGASWGN 272
gi 296197642 272 --PGGSWGS 278
gi 344307656 273 --PGGSWGN 279
gi 555968153 272 rpPGSSWSi 280
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap