Conserved Protein Domain Family
DUF4708

?
pfam15813: DUF4708 
Domain of unknown function (DUF4708)
This family of proteins is found in eukaryotes.
Statistics
?
PSSM-Id: 318107
View PSSM: pfam15813
Aligned: 13 rows
Threshold Bit Score: 353.995
Threshold Setting Gi: 746860520
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 672030961    7 QSLFFIILPDLHKLCTVQITLSGRVAEIDIRSTQIK---MCRQLLLSHEDILTAPVPGIL-----NQISVVMSIPFFKSG 78
gi 620984779    7 ESLFFTSLPDFQKLCAVRVTLNHAVPDTEIRSAQMK---MCRQLLFSQPDVLASPDPGRL-----DKILVVMAITFYKSG 78
gi 637290075    7 QSLFFISLPELQNLCAVKVTVSSQLDATGVRASQRK---LCRQLVLLHQEVIVSPILGTL-----NEISVIMPISFYKSG 78
gi 573893612    7 QSLFFITLPDLRKLCSVNISQLCDPDDGETRNNQIR---ICRELLFLCPELLASPVLDSF-----GEITVIMAITFFKTG 78
gi 1039383982   7 kSLFFLGLPDLTQLVCVTLS-PLEEEQQEPRTNQIK---TCRELVLLYSDILSCPALDSI-----TDVTAVMSVHFLQRG 77
gi 675871522    1 --MYFFNCPDLENLFVIYVKVPDLKSYPQA---HVS---LCKNLIFTEPDVLASPFSIRE-----KCFLVCMSKKLLFTK 67
gi 746860520    5 vkIFNVTIPPKDGLCCMICKIINSENDSLIYSNYCRnklKCGQFLRETPQAMAAPITNRKllelgNSLYVIVTKDFLESY 84
gi 971383200    7 QSLFFAGLPELQKLCATTITLSPQLPESEMRSTQIK---VCRQLIFLYQDVLSAPVIGTL-----NQISVVMAIPFYKSG 78
gi 565323254    7 QSLFFSSLPDLQKLYALKITLSSQLAATEVRTEQWK---MCKQLLLLCQGIISSPAPGTL-----NQISVIMTIPFYKTG 78
gi 821465468    7 QSLFFISLPDLQKLYAVKVILSNQVA--EIRSVQMK---MCRQLLLMHQELLTSPVPGIL-----NQIWVVMAIPFYKSG 76
gi 982965064    7 QSLFFITLPDLHKLCAVKIILSNGVAGTEIRSRQMK---ICRQLLFLHQDILTSPVPGIF-----TQIWAVMAITFYKAG 78
gi 348561507    7 QSLFFITLPDTQKLCAVPVTLSNRVADAELRSTQMK---MCRQLLILHEDILASPIPGTF-----NQIWIVMAIPFFKAG 78
gi 686756151    7 QSLFFITLPDLNKLCAVRIILSNKVADTEIRTIQMK---MCRQLLFLHQDILTSPVSGIL-----NQIWVVMAIPFYKAR 78
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 672030961   79 RLNAYIEKYEAKMEAPQRVTP-AILQNCLSYSLMARLAPAWNRTGHLLVQGRDFLSNMGKQSAVVLDIN-VTETQVCLSI 156
gi 620984779   79 KLQDYARSHGATMEAPQRVVP-DILQTCLSYSLSARLAPSWNKVGQLLVQGRDFLCKMGKQSAVALEYN-VSETQLCISV 156
gi 637290075   79 KCQAYIEKHGATMAVPERVIP-AIFQTCLSYTLIAKLAPKWNQAGHLLIQGKDFLSQHGKQNAIVMDIN-VLETQLCISV 156
gi 573893612   79 IIQAYTQRHSLQMGTPRRVLP-AILKACLSYTLTAKMAPEWNKAGQFLIAGTDFLTESGRLNAVVMELN-ATETQLCICV 156
gi 1039383982  78 VLQAFAIRNCLQLRGPHTPFP-GDLQCCLSYSLISRLAPSWNKAGLYLISGADFLTQRGTLSAVSLELS-TSGGRLCLSI 155
gi 675871522   68 RIQNRLIKKELSLGEAVQANP-ETFEMCLRYTVITRLSPNYNVLASFLVEGERFLFTPTRLNAIDLNIH-VTNQKITMNA 145
gi 746860520   85 TFRDHCDALNIQIMDLLDPFPnYIYKMCLLYTVEHRLAPQWNKVGLYLVEGQDFLSSTGNVNAIMLNIKdIRDNSAQFHV 164
gi 971383200   79 LCEAYVERQGATLEAPQRVNP-AILQTCLSYTLTARLAPRWNKAGHLLVQGKDFLSQMGRQNAVVLDIN-VSETQLCISV 156
gi 565323254   79 TFQVYVDKHGATVGMPERVSP-TIFQVCLSYTLRAKLAPNWNQAGHLLIQGRNFLSQMGKQNAVVVDII-VSETQLCISV 156
gi 821465468   77 KLQAYTEKHGAKVVTPQKVVP-AILQTCLSYSVTARLSPSWNKAGHLLIQGRDFLSQTGKQSAVVLDIN-VTESQLCLSI 154
gi 982965064   79 KLNAYMEKYGAKVEAPQQVIP-IILQNCLSYSLTARLAPAWNKAGHLLIQGREFLSQMGKQSAVVLDIN-VTSTQVCLSI 156
gi 348561507   79 KLNAYIEKYEAKMESPQRVIP-AILQNCISYSLTTRLAPAWNRAGHLLVQGKDFLSQMGKQSAVVLDVN-VTETQICLSI 156
gi 686756151   79 KLNAYVEKYGAKMEAPQRVIP-VILQNCLSYSFMARLAPAWNRTGHLLIQGRDFLSQMGKQSAVVLNIN-VTETQVCLSI 156
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 672030961  157 EVYTIRLPPPELQEFDISQHIIEDFHTNQNAVIERHSILSN-WCYILPSMKMGQIINFLHTAPPDCPFHSFEDFQRHWDD 235
gi 620984779  157 EACTIRLPPPELEDFEISENILKGFEAHEEAVIQQRSILNN-WCYILPSMKMGQIINILHTIPTDCPFKSYGDLQAHWDN 235
gi 637290075  157 EVSTIRLPPAKLEDFDISTNIIKKFDSDGSAVIQSCSILSN-WCYVLPSMKMGQIINISHFIPSDSPFQSYNELQLHWKN 235
gi 573893612  157 EAKSIRLPPAKLEDFDISANAVKNFYSSRDAEIQTYAISNN-WCYILPSMKMGQIISISHLLPSVCPFESYTEIQKHWNI 235
gi 1039383982 156 EASAVRTPPPMLDDLGLPAPVLQRFCSDPDFILDPSSTEGPvWCHVLPSMKKGQIISISRQLPRDGPFRTYGDLQSHWNR 235
gi 675871522  146 YTCALSMPVTSINHFGV------HFNQNSNSHITPQLINCK-WCFVLPSLKKGKVCSIHKSFPLNDCFKCYRELKIFWRD 218
gi 746860520  165 EAINLKIPFLRLN------------------TIHPSQHDSHpPVRVLPSLKMATVLSISKEIKGKHLFKNYEDMRTYWKN 226
gi 971383200  157 EACSVRLPPPELGDFDILANTIKLFESNENTVIDSHSILTN-WCYVLPSMKMGQIINISRIIPPESPFHSYEEFQMHWKN 235
gi 565323254  157 EICRICLPLPELEDFDISTNIIKNFNNDTTAVISECSILSN-WCYVLPSMKMGQIMSISHLIPHDSPFHSYSDLQLHWEN 235
gi 821465468  155 EVCTIRLPPPQLNDFDISENILKNFDGNKHAIIEGHSILSN-WCYVLPSMKMGQITNILHTVPPDCPFRSHEDFQMHWDS 233
gi 982965064  157 EVHTVRLPPPQLREFDISQSIIKSFETNQNAVIEEQSILSN-WCYVLPSMKMGRLISILHTIPPDCPFHSYEDFQMHWDG 235
gi 348561507  157 EVCTIRLPPPELEEFDISQSTIENFHTNKNAIIETHAILNN-WCYILPSMKMGQIINILHAIPADCPFHSFEDFQMHWDD 235
gi 686756151  157 EACTIRLPAPELKEFEISQSIIKDFHANKHAVIDRHSILSN-WCYVLPSMKMGQIINIFHAIPPDCPFHSYGDFQRHWDA 235
                         250       260       270       280
                  ....*....|....*....|....*....|....*....|....*
gi 672030961  236 LYGYKLPEDCGDMKIYCSIYFKMIDKRTFTYPLSCIRSQPMQFFP 280
gi 620984779  236 LYGYKLPEDGGATKVYCSIYFKLIGERLFTYPLSCIRSQPVQFYP 280
gi 637290075  236 LYGYSLPKDSQK---YCNIYFKFIGEQLFTYPMSCIRSQPVQYFP 277
gi 573893612  236 LYGYKIPAVNGENEVYCNVYFKLVGERLFTYPLCCIRSQPVQCFs 280
gi 1039383982 236 LYGYRLP-DLQEGGVYCSVYFRPVGEKLFTYPLSCIRLQPVQRCP 279
gi 675871522  219 IYGYVLPEN-ESDVFFVKVGFG-FTDEMFLYPSCCVKCfepiiik 261
gi 746860520  227 MHGYILPDH-KEELLFYSIEFFYFKSCVYLYPETCLTSGPLKILP 270
gi 971383200  236 LYGYILPEDIEEREIYLSVYFKPIGERLFTYPLRCIRSQPVQYFP 280
gi 565323254  236 LYGYLLPEDSQ------------------IYPSSCIRSQPIQYFP 262
gi 821465468  234 LYGYNLPEDCGKMEIYFTVYFKLIGEKLFTYPLSCIRSQPVQFFP 278
gi 982965064  236 LYGYKLPEDLGTIKIYCCIYFKMIGERLFTYPLSCVRSQPIQFFP 280
gi 348561507  236 MYGYKLPEDGRNIKIYCSIYFKMISERTFTYPLSCIRCQPIQFFP 280
gi 686756151  236 LYGYKLPDDCGKIKIYCNIYFKMLGERTFTYPLSCIRSQPMQFFP 280
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap