Conserved Protein Domain Family
MKRN1_C

?
pfam15815: MKRN1_C 
E3 ubiquitin-protein ligase makorin-1, C-terminal
MKRN1_C is the very C-terminus of E3 ubiquitin-protein ligase makorin-1, or MKRN1, a family of eukaryotic putative ribonucleoproteins with a distinctive array of zinc-finger motifs. MKRN1 plays an important role in modulating the homeostasis of telomere-length through a dynamic balance involving the stability of the protein hTERT. MKRN1 has been shown to be a a transcriptional co-regulator and an E3 ligase. It functions simultaneously as a differentially negative regulator of p53 and p21, preferentially leading cells to p53-dependent apoptosis by suppressing p21. The exact function of the C-terminal region has not been determined.
Statistics
?
PSSM-Id: 318109
View PSSM: pfam15815
Aligned: 5 rows
Threshold Bit Score: 106.538
Threshold Setting Gi: 57864224
Created: 30-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 351704179  30 PQRQKVGTSSRYWVQQRNHFWELTEERENRSPFDNDEEEAVTFELDKMLLMLLAASGGNELTDTDNEWDLFHDKLEDFC- 108
gi 57864224  262 PQRRQTGSSSRNRNSRRTQLWDIIDERESTGSLDNDDEEMVTFELSEMLLMLLAAGNDEEVTDSEDEWDLFHEELDDFY- 340
gi 297709758 431 PQRQQVGTSSRNPGQRRNHFWEFFEEGANSNPFDN-EEEAVTFELGEMLLMLSAAGRDDELTDSENDWDLFCDE--EFCv 507
gi 585154298 412 PQRQGAGESGAHCSQ----LLEPTQVGEGEIPFKSSKKELVMLRLANLLFKCFLSLANDELSFSEDQWDLLHYERENFF- 486
gi 118344564 347 PQRRQTGSSSRNRNSRRTQLWDIIDERESTGSLDNDDEEMVTFELSEMLLMLLAAGNDEEVTDSEDEWDLFHEELDDFY- 425

                 ...
gi 351704179 109 -DL 110
gi 57864224  341 -EI 342
gi 297709758 508 lDL 510
gi 585154298 487 -QF 488
gi 118344564 426 -EI 427
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap