Conserved Protein Domain Family
TMEM40

?
pfam15817: TMEM40 
Transmembrane protein 40 family
TMEM40 is a family of eukaryotic membrane proteins.
Statistics
?
PSSM-Id: 318111
View PSSM: pfam15817
Aligned: 3 rows
Threshold Bit Score: 244.047
Threshold Setting Gi: 884869575
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134035046 113 ELQLYGDAPGEVVPSGESGLRRRGSDPA-SGEVEASQLRRLNIKKDDEFFHFVLLCFAIGALLVCYHYYADWFMSLGVGL 191
gi 884869575  84 ALQLYRDDSGEVVPSEETGLRQRGVGPT-EGAVEDSQLSRLNIKKDDEFFHFVLLCFGIGALLVSYHYYADWFMSLGVGL 162
gi 821470360 109 ELQLYGDTSGEKKPYGELELRRREVSPTeEPEMEDTQARRMNIKKDDEFFHFVLLCFAIGSVLVCYHYYADWFMSLGVGL 188
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|.
gi 134035046 192 LTFASLETVGIYFGLVYRIHSVLQGFIPLFQKFRLTGFRKT 232
gi 884869575 163 LTFASLETVGIYFGLVYRIHSVLRGFLPLFQKIRQLGFRRT 203
gi 821470360 189 LTFASLETVGIYFGLVYRIHSVLQGFIPLFQKIRLIGFRRS 229
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap