Conserved Protein Domain Family
CCDC73

?
pfam15818: CCDC73 
Coiled-coil domain-containing protein 73 family
CCDC73 is a family of eukaryotic coiled-coil containing proteins. The function is not known. The alternative name is sarcoma antigen NY-SAR-79.
Statistics
?
PSSM-Id: 318112
View PSSM: pfam15818
Aligned: 12 rows
Threshold Bit Score: 1326.77
Threshold Setting Gi: 1020982037
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146286065    28 LLDFRTSLLEALEELRMRRKAETQYEEQIAKIILETQELKWQKEALQNQKEALIKQHKEAMGVLKNQLQMKMYALEEEKG 107
gi 512979292    28 LLDFKTSLLEALEELRMRREAEIQYEEQIGKIIMETQELKWQKETLQNQKEALVKQHKEAMEVFKKQLQMKMYALEEEKG 107
gi 300796278    28 LLDFKTSLLEALEELRMRREAETQYEEQIAKIIMETQELKWQKETLQNQKDTLAKQHKEAMAVFKKQLQMKMCALEEEKG 107
gi 432116972    28 LLDFRTSLLEALEELRMRREAEIQYEEQIGKIIVETQELKWQNETLQNQKETLTKQHNEAMAVFKKQLQMKMCALEEEKG 107
gi 1003777633   26 LLDFKTSLLETIEELRIRRETEINYEDQLSKIVVEKQELEWQKETLQHQTDTLQQQNKEAMAAFKKQLQTRMFAMEEEKG 105
gi 1020982037   26 LLDFKTNLLEAIEELRIRRETETNYEDQINKIVIEKQELEWQKETLQHQTDTLQQQNKEAMAAFKKQLQARMFAMEEEKG 105
gi 914910730    28 LLDFKTSLLEAVEELRMRREAETKYEEQIGKIIVETQELKWQKETLQSQKEALVKQHKEAMEIFKKQLQMKMYALEEEKG 107
gi 351714949    28 LLDFKTSLLEALEELRMRREAEIQYEEQIGKIIMETQELKWQKETLQNQKEALVKQHKEAMEVFKKQLQMKMYALEEEKG 107
gi 1040158570   27 LLDFKTSFLEALEELRMRREAETQYEEQIGKIIVEIQELKWQKESLQNQKETLVKQHKEAMAVFKKQFQMKMCALEEEKG 106
gi 831211785    28 LLDFKTSLLEALEELRMRREAETQYEEQIAKIIVETQELKWQKETLQNQKETLAKQHEEAMAVFKKQLQMKMCALEEEKG 107
gi 344280822    27 LLDFKTSLLEALEELRMRREAETQYEEHIGKIIVETQELKWQKETLQNQKETLAKQHEEAMAVFKKQLQMKMCALEEEKG 106
gi 752396814    47 LLHFKTSLLEALEELRMRREAETQYEEQISKIIAETQELKWQKETLQNQKETLAKQHKEAMAAFKKQLQMKMCALEEEKG 126
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146286065   108 KYKLATEIKEKEIEGLKETLKTLQVSQYSLQKKVSEMEQKAHLYHLAKEDYHKQLNEIEKYYAAITNQFGLVRENHVKLE 187
gi 512979292   108 KYQLASEIKEKEIEGLKETLKELQVSKYSLQKKVSEMEQKVQFHLLAKEDYHKQLNEIEKYYATITNQFGLVKENHVKLD 187
gi 300796278   108 KFQLATEIKEKEIEGLKETLKTLQVSKYSLQKKVSEMEQKVQLHLLAKEDHQKQLNEIEKYYTIITGQFGLVKENHEKLE 187
gi 432116972   108 KYQLATEIKEKEIEGLKETLKALQVSKYSLQKKVSEMEQKLQLQLLAKEDHQKQLNEIEKYYATITGQFGLVKESHGKLE 187
gi 1003777633  106 KYQLAVEIKEKEIDGLKETLRELQIAKYTLQKKLNEMDQKLQMHLTAREEHHKKLNEVERCYATIASQFGVVKGVHGKLE 185
gi 1020982037  106 KYQLAAETKEKEIDGLKETLKALQISKYTLQKKLNEMDQKLQMHLTAKEEHHKKLNEVERCYATIASRFGVVKGVHGKLE 185
gi 914910730   108 KYQLAAEIKEKEIEGLKETLKALQVSKYSLQKKVSEMEQNVQLHLLAKGDYHKQLNEIEKYYATITKQFGLVKENHGKLE 187
gi 351714949   108 KYQLASEIKEKEIEGLKETLKELQVSKYSLQKKVSEMEQKVQFHLLAKEDYHKQLNEIEKYYATITNQFGLVKENHVKLD 187
gi 1040158570  107 KFQLATEIKEKEIEGLKETLKTLQVSNYSLQKKMSEMEQKVQLHLLAKEDYHKQLNEIEKYYTAITGQFGLVKENHEKLE 186
gi 831211785   108 KYQLATEVKEKEIEGLKETLKALQVSKYSLQKKVSEMEQKIQLHLLAKEDYHKQLSEMEKYYATITGQFGVVKENHEKLE 187
gi 344280822   107 KYQLATEIKEKEIEGLKETLKALQVSKYSLQKKLSEMEQKVQLHFLAKEDHHKQLNEIEKYYAIITGQFGLVKENHEKLE 186
gi 752396814   127 KYQLAAEIKEKEIEGLKETLKALQVSKYSLQKKISEMEQKVQLHLLAKEDHQKQLNEIEKYYGTITGQFGLVKENHEKLE 206
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146286065   188 QNVQEAIQLNKRLSTLNEKQESEIHSLKKELKKAASELIKSKVTC-QHKMEEESIDLIIKEQKYEELQERLNMELEVNKK 266
gi 512979292   188 QNVQEAIQLNKRLSALNKKQESEICSLKKELKKAASDLIKSKVIC-QYKMKEENINLTIKEQKLEELQEKLSMELELNKK 266
gi 300796278   188 QNVQEAIQLNKRLSALNKKQESEINSLKKELKTVTSDLIKTKVTCqQQKMGAEN-NLTIKEQKFQELEERLHMELELNKK 266
gi 432116972   188 QNVQEAIQLNKRLSALNKKQESELCSLKKELKKVTSDLIKSKVTW-QHKMGEENINLTIKEQKIQELQERLNMELELNKK 266
gi 1003777633  186 HSVQEAIQLNKKLTSVNKRQETEISNLKEELKKVTTDLIRSKVTS-QNRVGEENINLAAKEKQFQELQQKIRMETAISER 264
gi 1020982037  186 HSVQEAIQHNKKLASVNKRQETEISNLKEELKKVTTDLIRSKVNS-QYRVGEENINLAVKEKQFQELQQKIRMETAVSKK 264
gi 914910730   188 QNVQEAIKLNKRLSTLNKNQESEICSLKKELKKIASDLIKSKVTC-QYKVEEENINIRIKEQKFEELQERLNMELELNKK 266
gi 351714949   188 QNVQEAIQLNKRLSALNKKQESEICSLKKELKKAASDLIKSKVIC-QYKMKEENINLTIKEQKLEELQEKLSMELELNKK 266
gi 1040158570  187 QNVQEAIQVNKRLSALNKKQESEICSLKKELKRVSSDLIKSKVTC-QYKMEEENINLTIKEQKFEELEERLNVELELNKK 265
gi 831211785   188 RNVQEAIQLNKRLSALNKKQESEICSLKKELKNVASDLRKSKVTW-QYKMGEENINLTMKEQKFQELQERLNMEFELNKK 266
gi 344280822   187 RNVQEAIQLNKRLSALNKKQEFELCSLKKELKKVTSDLIKSKVTC-QYKMGEENTNLTIKERKFQELQERLNMELELNKK 265
gi 752396814   207 QNVQEAIQLNKRLSALNKKQESEICSLKKELKKVTSDLIKSKVTC-QHKMGEENIHLTIKEQKFQELQERLNMELELNKK 285
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146286065   267 INEEITHIQEEKQ---------------DIIISFQHMQQLLQQETQANTEIDAELKVLRENNQTLERDNELQREKVKENE 331
gi 512979292   267 INEEIIHIQEEKQ---------------DIFTSFQHMQQLLQQQTQANNEMDAELKALKEKNQTLERDNELQRKKVRENK 331
gi 300796278   267 INEEITCIQDEKQ---------------GIIISFQQLQQLLQQQTQANTEMEEKLKVIKENNQTLERDNELQREKVKENE 331
gi 432116972   267 ITEEITHIQEEKQasnlfkidmfiyflkDIIISFQHMQQLLQQQTQANTELEAELKVQRENNQTLERDNELQREKLKENE 346
gi 1003777633  265 VQEENANIKEEKL---------------EILSSLQCAQKQLQRITQTNVRMESELNALREEYQTLERDNELQREKAKENE 329
gi 1020982037  265 VQEENTHIKEEKL---------------EILSSLQCVQELLQRITQANVRMESELNALKEDYQALERDNELQREKAKENE 329
gi 914910730   267 INDEITHTEEEKQ---------------AIIISFQQMQQLLQQQIQANTEMDAELKMLKENNQTLERDNELQREKVKENE 331
gi 351714949   267 INEEIIHIQEEKQ---------------DIFTSFQHMQQLLQQQTQANNEMDAELKALKEKNQTLERDNELQRKKVRENK 331
gi 1040158570  266 INEEITYIQEEKQ---------------GIIISFQHMQQLLQQQIQANTEIEAEFKILKENNQTLERDNELQREKVKENE 330
gi 831211785   267 INEEVTHIQEEKQ---------------DIIISFQHMQQLLQQQIQANTEMEAELKALKENNQTLERDNELQREKVKENE 331
gi 344280822   266 INEEISRIQEEKQ---------------NVIISFQHMQQLLQQQTQANAEMKAELKVLKENNQTLERDNELQREKVRENE 330
gi 752396814   286 INEEIAHVQEEKK---------------GIIISFQHMQQLLQHQTQVSTELEAKLKMLKENNQTLERDNELQREKVKENE 350
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146286065   332 EKFLSLEKEHERALGTWKKH-------VEELSGEMNVIKNELSSLRETHAKLQEHYNKLCEQKKTEEYKKFQNVP----- 399
gi 512979292   332 EKFLNLQNEHEKAVGTWKRHigllnckVEELNREINEIKDEFSSLKETHIKLQEQHNKFWSQKKLEEDKKFQNVP----- 406
gi 300796278   332 EKFLNLQNEHEKALGTWKKH-------VEELNGEINEIKSELSSLKETHTKLQEDYDELCDQkkfeEDKKFENLP----- 399
gi 432116972   347 EKFLNLQNEHEKALRTGGKH-------VALLFLNIAAAIWGL------------FWFHINFWsicsRYVKYANLP----- 402
gi 1003777633  330 EKFLNLQNEHEKALRIWKKE-------EETLRREMDTIKNELNSLKEAQGHLDDCHLPQGNQ----HSEQVENLQihstv 398
gi 1020982037  330 EKFLNLQNEHEKALKTWKND-------EENMRREIQTIKNELNSLKELHRHLEDYHPPQGNQ----HSEHVENLQm---- 394
gi 914910730   332 EKFLNLQNEHEKAQGTWKRH-------VEELIGEINKIKNELSSLKEIHIKFQEHYNKLCCQkkveEYKKFQNVP----- 399
gi 351714949   332 EKFLNLQNEHEKAVGTWKRH-------IE-LNREINEIKDEFSSLKETHIKLQEQHNKFWSQkkleEDKKFQNVP----- 398
gi 1040158570  331 EKFLNLQNEHEKALGTWKRH-------VEELTEEINEVKNELSLLKETHIKLQEHHNKFCEQrkfeEDKKFQNAP----- 398
gi 831211785   332 EKFLNLQNEHEKALGTWKRH-------VEELNGEINEMKDELSLLKETHIKLQEHYDKLCNQkkfeED-KFQNVP----- 398
gi 344280822   331 EKFLNLQNEHEEAQGTWKKH-------VEELNGEINEIKNELSSLKETHIKLQEHYNKIYDQkkfeEDKKFQNVP----- 398
gi 752396814   351 EKFLNLRNEHEKALGTWKKH-------VEELNGEINEIKNELSSLNETHIKLQEHYNELCDQkkleEDKKFQNIP----- 418
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146286065   400 -E------LNNENSdELtRKKSENIITQKYN--------------SgpeiW----GKNTKSFCL---DTEYRE--E-EKK 448
gi 512979292   407 -E------INNENH-EI-TENSGKAIIQKFN--------------S----R----EENTKGFCS---YTEYREk-DvMKE 451
gi 300796278   400 -E------VNT----EMsVEKSGNTIIQKYN--------------SrqeiR----EENTKSCCL---DTEYKEkgE-TKE 446
gi 432116972   403 -E------VNTENS-DMsMGKLQN-IIQKYN--------------S----RqeirEENKVNFCL---DTEYRTk-E-KKK 450
gi 1003777633  399 hP------VTRNSG-QEqSKdseiqTIQKENhcmpsilgkdnnfgHedeiE----VKNIVNFSL---GTEELQi-E-PKl 462
gi 1020982037  395 -QspaqpiPTNVSG-QEhSKDSEILAIQKENefmqsgiskcgncgNeeetE----VKTTRDKSS---STEELKt-E-QNP 463
gi 914910730   400 -E------INNENS-ER-TKKSENAIIQKYN--------------SgqeiM----EENTKSFYS---DAEDREe-E-EKK 447
gi 351714949   399 -E------INNENH-EI-TENSGKAIIQKFNs------------------R----EENTKGFCS---YTEYREkdV-MKE 443
gi 1040158570  399 -E------VNNENC-EMlTEKSENTIIQKYN--------------FeqekR----EENTESFSSyagDKETQQ--E-KKK 449
gi 831211785   399 -E------VNNENS-EMsTEKLENPVIQKY---------------SeqeiG----KENTEHFCS---DTRFREevE-KKK 447
gi 344280822   399 -E------VSNEHS-RMsAEKSEDTTILTYN--------------SgqeiR----EENSMNFCS---DTEYR---E-KKE 445
gi 752396814   419 -E------VNTKTS-ELsMEKSENIIIQKYN--------------SgqeiK-----KDTLSFHS---DTNYREk-E-KKE 466
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146286065   449 DLPVGk--TAEDLQPFEISAKSEINTMVSQDRNQSGMSPHRVLCLDKDATDQeQT--SDVTDSRKSVTVEVKDKLCLEKA 524
gi 512979292   452 SLATEv--TVEDVQRFEKSFKNETDTSIPQDKGQCGLSLSKPPCLGKDTISQ-QT--GSVTDPRKPAATETEDRLDLEKD 526
gi 300796278   447 gpflee--iiidlQLFEKSSKNKIDIVVPQDENQSEISLGKTLGREKELISEgQT--LDITNFTKVVTTEIKNKVDLEKD 522
gi 432116972   451 egplteeiiiediQHTEKISKNEIDPNVPQDEKQSEISISKTLCIEKELISQgQT--LNVTDFRKAATTEIKDKVGLERD 528
gi 1003777633  463 -------------QFLENSLKGEINIPSPLEGKEKEASPRNTLCADTDLITQgQKleVPVTECKEAENLETTCKVLLEGN 529
gi 1020982037  464 -------------QVLENSFKDEINVASPRELKQREACPRNTLCTDTDLTAQgHTseMHVTGGREAEDAGTAHRTLPDDS 530
gi 914910730   448 dlpiee-iiteglQLFEKSVRNEIDTTVSQDENQSEISLSKALYLDKDVISQkQT--VNVTHCRKSVTAEIKYKVVVEKD 524
gi 351714949   444 slatev--tvedvQRFEKSFKNETDTSIPQDKGQCGLSLSKPPCLGKDTISQ-QT--GSVTDPRKPAATETEDRLDLEKD 518
gi 1040158570  450 clpiee-tvikdlQLFEKNFK-KIDTAVSQDETPSEISLTNTLYIDKKVISLeKT--LNVTDCRKSVTTEIKDKMCLEKD 525
gi 831211785   448 gpsvee-iiiedlQVLEKTFKNGMDTTVSQNKNQSEISLTKTHSRGKEVISQgQT--LNATDIRKSVTTEIKDVMCSEKD 524
gi 344280822   446 gppkee-iiiedlQLLEKSCKNEIITTVPQDENQSEISLSKVLCTDKEVISQgQT--LNVPDFRKSITTEIKDKLCLEKD 522
gi 752396814   467 gpfieg-giiedlQLLEKNTKNEIDPAISQAENQSETSLSKTLSTEKELISQgQT--LNVTDFRKAVTSEIKDKVGSGKD 543
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146286065   525 SGCSEFKSLNNFFLVvdesletemvrlEGTEGLG--LLHSggDIPLDTRSNKASSNGMSNEMAH-----KR---NYNTDG 594
gi 512979292   527 SGCTEFKPPNNLCLV------------EGAEGSG--LHPA--CVRLESKDQRSSPDRTVSETAH-----NG---DHDKDV 582
gi 300796278   523 NEGTELKSPSIPFVVadssmetekihlERTEGLD--LHHA--NTHLGVENNSTSFNSILNEMAC-----HT---NHKKDV 590
gi 432116972   529 NESTEFKSPNNSFLGadtsietdsihlERTEGFD--VHRP--DLHLEVESNRISFNSVLNEMAH-----ST---NHKKDI 596
gi 1003777633  530 SANVQQKQQDSSGPAaahhtetskallDAADRaaslVCEK--NAIQEMNSSNQEQCNATHESICtkadkNSsitELDKSV 607
gi 1020982037  531 NANLDQKPLDSTEPLaaqhtqtrkdflGSAERKSvgADRK--NGSQETDTSKEELCGTADESACakagaNSdtrQHNRSV 608
gi 914910730   525 NECTEFKAQNNPLLVvdlstetkkiplERMEGLD--LHHT--DIHLEIENNRASFNNVVNETAC-----N----RNNKEV 591
gi 351714949   519 SGCTEFKPPNNLCLV------------EGAEGSG--LHPA--CVRLESKDQRSSPDRTVSETAH-----NG---DHDKDV 574
gi 1040158570  526 NVCTEDKLPNNPSLVvdpaeetekvhlEITD-----LAHA--DAHLEAEKNRTLFNSILNDMVH-----NT---SQNKDG 590
gi 831211785   525 DGPSEFKTPNHPFLVvdsaketekiclERTERLElgLHHA--DIHLEVENNRTSFNSILNETAH-----NA---NHNKDV 594
gi 344280822   523 NGCTEFQSPTSLILVadtsietkmihlESMGGLD--SHHP--DVHLEAENHRSC-DSILND--------NT---NHSKDV 586
gi 752396814   544 NGCTEFKSPNGSFLVadrstetgkihlGSTEGLH--LHHA--DVHPEVENTRPS-NTTLSETAY-----QT---NQKKDV 610
                          650       660       670       680       690       700       710       720
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146286065   595 SESNPFKQQSKLLPADLENATekeitnqDQTKAGLDSFLDIKLNLDP--CKKHGLQDSSHVTLDVKHQKIKQ--MVREES 670
gi 512979292   583 SENKPFRQQFRSHLGTKRGIT-------NRSKAGLGSSLDAKMNPVQ--CEKYSFQDSRNARVSDKQCKMEHtqLLNKIS 653
gi 300796278   591 SEDEPFKQQLRLFPGTQENTTekvitnsHQIKTDLDSSVDIKRNLVQ--PQKYSLQDSNNvMLDDKQCKIRqtqLLNKKS 668
gi 432116972   597 SEQ-----QFRLLPETQENATkktvtnsDQAKIDLDSSLDVKKNPVQ--CQRYNLHDSSNvILDDKQCKIEqiqLVNNKS 669
gi 1003777633  608 LTTEASKKESEAAVGTEKSAVcerntgnhqvnefhfgilsyakencqteHQKCSLLNSDK-DVDNRSHRIEkslLNLCGL 686
gi 1020982037  609 LTPEAPKPQSEAVLCTERSALherstdsHQAKQLSFGILHSTKENSQaeYQKCSLLNSDN-SVGSGLHKAEk-tLNLSGL 686
gi 914910730   592 SEHKPFEQQFRLHLETQENATgkeiinsAQTKTDLDSSPDIKMIPGQ--CEKYGSQDSSHiILDDKQCKIKqiqLFNKKS 669
gi 351714949   575 SENKPFRQQFRSHLGTKRGIT-------NRSKAGLGSSLDAKMNPVQ--CEKYSFQDSRNaRVSDKQCKMEhtqLLNKIS 645
gi 1040158570  591 SESEPFK-QFRLLLGTEENATkneitnsDQTKAALDSSLDVKKNSVH--CQKYSLQDSSSvMSDDKRCKIKqiqLLKENS 667
gi 831211785   595 SENESFK-QFSSLLGTQENTTkka--nsDQTKADLDSSLDVKKNPVL--CQKYSLQDSSNvLLDDEQCKIKqiqLLNKKS 669
gi 344280822   587 SENEPFKQQFRLLPCTQKSTAervmtntDQTKAELDSSLDVKEKPVH--WEKCSLHNSSSvMLDDKRCKTKq--LLRTQS 662
gi 752396814   611 SEDEPFK-RFRLLPGIQENATdkeitktDQTKPDLGASLNINKNAVQ--CQKYSLQESSN----DKQCKTNqmqLLNKNS 683
                          730       740       750       760       770       780       790       800
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146286065   671 QCSTEP----RSCYQLAS--------------------KAP------QKPGGTIACAAvVS-PLGPSASSDNKLTaLKKS 719
gi 512979292   654 EYSILPfkptSSFPQVCN--------------------DTL------EKPELTLPHDE-VNhLMSPAAPAENSKA-LPDS 705
gi 300796278   669 ECSLLPfketSDVQQVGE--------------------GPS------EQPQLAIPCDTaINhPISSAVFSDNLNVlLKNS 722
gi 432116972   670 ECSTLPlkqtSDVQQICK--------------------DTS------EKPGLTIPYDIaVEyPISSAVFSDNLKVfLKNS 723
gi 1003777633  687 PRDKFPfkqtRVDAEDNNyndnasnsnrsgmlrhtgfpAMD------AQNLLAVYCNDaSTd---------------KAA 745
gi 1020982037  687 HRDKLPleqtQVDAEGRNddnvrnv-------nntgvlAIDavpetsAQHPPTVCCDN--------------ASAdAAAA 745
gi 914910730   670 EYSILPfkqtSNIQQICQ--------------------DTS------EKTELIPPCDVvINhLISSAAFDDNVKA-LKNT 722
gi 351714949   646 EYSILPfkptSSFPQVCN--------------------DTL------EKPELTLPHDE-VNhLMSPAAPAENSKA-LPDS 697
gi 1040158570  668 EYSILPfkqtSYFQPVCS--------------------DNP------EIPELTVPCDTvINhPISSAAFLDNLKVpLKNS 721
gi 831211785   670 ECNPLLfketSEFQQVCN--------------------DTS------EKPELTVPCNTvIDhPFSSAAFSDNLKI-LKNS 722
gi 344280822   663 ECGILPlkqtSDFQQLCN--------------------DTS------EKAQLNIPCDTaSSyPISYAAFSDNLKL-LENS 715
gi 752396814   684 ECSVSPfkqtSVLQQICN--------------------DPS------EKPELTIPSDTaANhPISSAAVSENLKVlLKNS 737
                          810       820       830       840       850       860       870       880
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146286065   720 ENSINTLPTAAKPAPSPAERTTRTNTNDIQNSSLRNHLGASE-SSVSVSDFQVNQGDSHTSQAKGLKTVVPlTTSSEKQP 798
gi 512979292   706 GNHIGIMPMLVTPNSNPRGRAVRKDRKDMQDSPFKSCLGCPG-KGVTTAPLHLNSEDTRASADTDLETALR-KTAMEVQF 783
gi 300796278   723 DKIVNIMPMLVTPNSSPGKRTIWKNLNDMQNSQFENclGCLE-NNVTLSHLQINNENIDASQAKDMKTASHvKTSTEMQF 801
gi 432116972   724 DTNVNMMPILVKPNSSPGKSAVCKNLNDSQ-SSFKDclGDSE-NSMNISQLQVNNENIHTSQAKDMKTAVHmKTCTEMQF 801
gi 1003777633  746 KEHSSNMPLTSTYNLCPGKINKGINVDDVHSKQPEH--DSTEqLGGDRSMCTLNAEAVPPVKDDGLDTG-QkVPADGIAA 822
gi 1020982037  746 KECRENKSLSGTFNLCPPKTGRGINADDMHSKQPEQ--GGAKpTGNAANRWASNAEAKSPVKADGLKIAQKpPPTDRACT 823
gi 914910730   723 DNSISITPTLEKFSSIPGERAVWKNMNDMQNHQFKNclGYLE-DNITISHLQVNDENSHTSQAKDFKTDVHmKTSKEIEF 801
gi 351714949   698 GNHIGIMPMLVTPNSNPRGRAVRKDRKDMQDSPFKSclGCPG-KGVTTAPLHLNSEDTRASADTDLETALR-KTAMEVQF 775
gi 1040158570  722 DKNINIMPVLVKPNAGPEEGTMWKSMSDMKNSQLKNclEYLEnSHVTISHLQVNDDSSHASQTGDVKTDARrKTSTETQF 801
gi 831211785   723 DKNVNSMSMLVKLNSSPGQRPMWKNMDDKSDSQFKNcsGYLEnNNVTISHLQVNDENSHASQAKDVKTAVHpKTSTEIQF 802
gi 344280822   716 DKKVSIVPMLVKPNSSPGKRTTRKNL-DAQSSQFKDclERLE-NNMTIPHLQIDNENIHASQPKDMKTAVYrKTSTEIQL 793
gi 752396814   738 DKNVNIMPMLMKPNSSPGEGTIWKNLNEMHTSQLKNclGYLE-NSATTSHLQVKNENIHTSEVKDMKTAVPtQTSTEIQF 816
                          890       900       910       920       930       940       950       960
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146286065   799 PS--------ESQITETPKSGLSSLVDVTGRQCMWLNNRDKTEALNGILSGGTCHEGQLEEAHLSPATPSADSVSTSARS 870
gi 512979292   784 YSerk---tdVSQITEATKHDPFLFVNVNERQHTLLNNTERTESLNDIVSGKLYSEGQQGESQSFHIKPSGNLVNRSGRA 860
gi 300796278   802 SNkes--qidENQITEVKKKDYF----PNERQHTLLNstEKTESLNDIVSGKIYSEGQLEESCSFHIKPSGDLVNISGRS 875
gi 432116972   802 SSkes--hidENQLTETTKSDLFLFVdVNERQHTLLNntEKTESLNDIVSGKIYSEGQLEESCSFHIKPSGDLVNRSGKS 879
gi 1003777633  823 DKl------nEEIQIQPIKNGHFLDVnDKSVNNTVLK--QTKDSVHSTVPGKKFAEVHLKESCSLPMRTSENV---SGRS 891
gi 1020982037  824 DKlilcknvnNGTQIHSIKTGHSLEI-DTSTNNTLLK--EKKGSLSSAVPGMKLAEGHLKESSSLPMRTSGNLVNISLRS 900
gi 914910730   802 SNesq---idENQITEVTKNDLFLFVnVNETQHMLLNntEKTESLNGIVSGKMYSEGQLEESDSFHIKPSGDLVNRSGRS 878
gi 351714949   776 YSerk---tdVSQITEATKHDPFLFVnVNERQHTLLNntERTESLNDIVSGKLYSEGQQGESQSFHIKPSGNLVNRSGRA 852
gi 1040158570  802 LNrq----idENQITEATKPNHFLFVnVNERQHTLLNntETTESLNDIVSGRMYSEGQLEESHSFPIKPSGDLVNTSGRS 877
gi 831211785   803 SNkei--qidKNQTTEATKNDLFLILnANERQHTLLNktEKTESLNDIVSEKMYSEGQLEESHSFHIKPSGDLVNRSGRS 880
gi 344280822   794 SSkds--qidENQITEATKNDLFLLVnVNERQHSLLNntEKTESLNDIVSEKIYIEGQLEESRSFHIKASGDSVNTSGMS 871
gi 752396814   817 SNkes--qidENQITDATKNDLFLSVnVNERQHSLLNt-EKTESLNKIVSGKIYSEGQLEESCSFHIKPSGDLVNRSGRS 893
                          970       980       990      1000      1010      1020      1030      1040
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146286065   871 AFDLPSPD-KPEKTPGYIKFVPLSPWPKVNQT--KTVGTATPSIPLFLKEKTVDLSGSRVITPVTFCKNVVLDDTRKN-I 946
gi 512979292   861 SFDLPTSDrKTEKTPAYMNFLDPGPWSKVNQTagQTVSPAMSSTPLLLKERPAGPSEHTKTTSVALCKNAGVDDVRQD-A 939
gi 300796278   876 AFDLSTSDkKTEKTLVYVNFLGPSSWSKVNQIesQTVSTSTSSIPLLLNERPVslLENKKTVSMTLCKNVSVDEARND-V 954
gi 432116972   880 AFDLSTSYkKTEKTPVYVNFLDPSSWSKVNQNesQTVSASTSGIPLLLNERPIgpSENEKIVSMTLCKN-----VRKD-I 953
gi 1003777633  892 FFDLSSSDkKAEKTSVCFKFFDLSSCSSVNQMrsQAAWTSSCQEPSVLKEKLPclVENKKVISRVLFQNNSENVGRKE-V 970
gi 1020982037  901 SFDLSTSDkKAEKSPLYLNFLALSSCSRVNQVrgQAAWTSASKEPSLLKDKPA--LENTNIISKTQSQNLSENVDSEE-S 977
gi 914910730   879 TFDLFTSDkKTEKTPVYMNFLDPDPWSKVNQTesQTVNTSTSSIPLLLKERPVgpTENKKRISKIICEKAGVDDDRKD-I 957
gi 351714949   853 SFDLPTSDrKTEKTPAYMNFLDPGPWSKVNQTagQTVSPAMSSTPLLLKERPAgpSEHTKTTSVALCKNAGVDDVRQD-A 931
gi 1040158570  878 AFDLPTSDkKPEKTPVYTNFLNPSPWSKVNQIesQTVSTSTSSIPVLLKERPLgpSEHKKIISVTLGKN--VDDIKKD-I 954
gi 831211785   881 AFDPSTSDkKTEKTPVYMNISEPGPWSKVNQIenQIVDTSTSSISLLLKEKQInpSQNKNTISMSLCKNVDMDDNRKD-I 959
gi 344280822   872 AFDLSTSDkKTEKTPVYLNFLDPGTWSKVNQIesQTVSTSASSILSSPKERPIgpSENKKIVSTTLGKNTGVDEVRKGvV 951
gi 752396814   894 AFDLSTSDkKTEKIPVYVNFLDPNPWSKVNQTesQTLSTSTSSIP-LLKERPIgpSENKNIVSVTLCKN--DDDIRKD-T 969
                         1050      1060      1070      1080      1090      1100      1110      1120
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146286065   947 ESDPTSNSRAADTMSNWSIHLDPKGQPREERNATAQTVYDSSFPTEH---------VKAEPLISTVQQSHSQTVKVT--- 1014
gi 512979292   940 GPDAVRITGVADAVSTRSVRPDPERTPSEERNATAGMGPDSSVPTEH---------VKAEPRVPTVLQSHFQSIETQ--- 1007
gi 300796278   955 GPDTTSINRVADTLNNSSIHPDPRGEPSEERNAIAKTFYDSSFPTEH---------VKtkplkstpLQSHFQAIKIK--- 1022
gi 432116972   954 GPDTTSINRVADTLNNSTIHPDPKGEPREERNATARTSCDSSFPTEH---------Clsaftvhfsgqftgtagacrygp 1024
gi 1003777633  971 GPGSTSSNGAADTLNTSSIHRDPQGDSTEEWNAIAKTFYDSSFPTEH---------MKegfnalneQKSSPMTLTPA--- 1038
gi 1020982037  978 GQGSSSLSRAANTLNASGIHREPQGEPSEEWNATAKAFYDSSFPTEHvteglaafqNK--------QKSPHMTVSPA--- 1046
gi 914910730   958 GPDTTTINRVADTLNNWSIHPDPKGEPSEERNATAKTFYDSSFPTEH---------VKakplistvLQSHFQAIKVK--- 1025
gi 351714949   932 GPDAVRITGVADAVSTRSVRPDPERTPSEERNATAGMGPDSSVPTEH---------VKaeprvptvLQSHFQSIETQ--- 999
gi 1040158570  955 EPDTTSMNRVADTLNNWSIHPDPKGGPSEERNAIAKTFYDSSFPTEH---------VNtkplssalLLSHLQAIESK--- 1022
gi 831211785   960 GPDTTSINRVADTLNNWSIHPDPKGESSEERNATAKTFYDSSFPTEH---------VEtkslkstlLQSHFEAIKSKgtv 1030
gi 344280822   952 RPDTTSINRVADTLNNSSIHPDPKGEPSEERNATAKTFYDSSFPTEH---------VKtkplkstlPRSPFQATEIK--- 1019
gi 752396814   970 GPDTTSVNRVADTLNNSSIHPDPKGEPSEERNATAKTFYDSSFPTEH---------AKikpvksvlLQSHFQATKIK--- 1037
                         1130      1140      1150      1160
                   ....*....|....*....|....*....|....*....|....*...
gi 146286065  1015 ---DSPDPLTFsPGNNdWQSLVMNRLTEIEKLLSLESDNQPKRRKVEE 1059
gi 512979292  1008 ---EPPDLPAT-PGED-WQSLVINQVTEIEKYLSLENDNQPKVRKAEE 1050
gi 300796278  1023 ---NTDSDVS--SGEDdWQHLVTNQINEIEKFLSLENNNQPKKRKAEE 1065
gi 432116972  1025 fgppppsqassgqarmfpnapylpsclesqpairnqgystvtfdgtpn 1072
gi 1003777633 1039 ---QSE-TLRDeDRCPtHNSTVQNQIEEIEKFLNLERLCSSRKRKHED 1082
gi 1020982037 1047 ---RSEKALKDeDSCSlQNSIIQNQTGGIEKLLNLERLHSARKRKYEE 1091
gi 914910730  1026 ---DAPDLAAF-SGNNnWKSLMTNQIT--EKFLSLENGNQFKKRKAEE 1067
gi 351714949  1000 ---EPPDLPAT-PGED-WQSLVINQVTEIEKYLSLENDNQPKVRKAEE 1042
gi 1040158570 1023 ---DPTDFAAA-SGEDkWQSLVTNQINEIEKFLGLENDSQPKKRKAEE 1066
gi 831211785  1031 dlaAP-------SGEDeWQRLITSHINEIEKFLNLENDNQPKKRKAEE 1071
gi 344280822  1020 ---DTTDLAASfTAEDdWQSLVTKQINEIEKLLSLESDNRPRKRKAEE 1064
gi 752396814  1038 ---DPTDVGASsTGEDdWQSLVRNQINEIENFLSLENDNQPKKRKAEE 1082
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap