Conserved Protein Domain Family
Fibin

?
pfam15819: Fibin 
Fin bud initiation factor homolog
Fibin is a family of eukaryotic proteins expressed in the lateral plate mesoderm of presumptive pectoral fin bud regions. It acts as a signal molecule for the expression of Tbx5, a gene involved in the specification of fore-limb identity. Fibin is found to be expressed in cerebellum, skeletal muscle and many other embryonic as well as adult mouse tissues, suggesting roles in both embryogenesis and in adult life. Although Fibin is routed through the endoplasmic reticulum (ER) no significant evidence for secretion is found. Fibin is post-translationally modified and forms dimers when expressed heterologously and its expression is regulated by a number of cellular signalling pathways.
Statistics
?
PSSM-Id: 318113
View PSSM: pfam15819
Aligned: 11 rows
Threshold Bit Score: 324.002
Threshold Setting Gi: 478431071
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 292630308   33 LCGAVYEGPLLPEMSNGTFHHFFVPDGDYEETEDPEKCQMLFKWID-RRPCPLEEDr-dT------VIREDFVIVKQQIE 104
gi 301619099   15 LCHGYYTGPLFPEMSNGTLHHYFVPDGDYEENDDPEKCQMLFKVRD-DRPCTYEDA---L------SLKDEFIIIKRQFE 84
gi 432861561   39 fgSAVYTGPLQPEISNGTFHHFFVPDGDYEETVDPEQCQMLFKFSD-VYPCGHAEEgsdA------AVRDDFVISKLQAE 111
gi 928166096   15 LCGGYFDGPLYPEMSNGTLHHYFVPDGDYEENDDPEKCQLLFRVSE-RRRCPPGDAg-pGrgalslSLRDEFTVLGRQVE 92
gi 597766313   16 cAHALFLGPLHPEMSNGTFHHYFVPDGNYEENDDPEQCQMLFRVTDeRRPCGEDADa-dA------AVREDFTLARRQAE 88
gi 410912720   15 TCGAYYSGPLQPEMSNGTFHHYFVPDGDYEENDDPEKCQMLFKVND-ERRCGLDEDq-dA------VIRDDFTIIRRQIE 86
gi 556974703   15 LCQGLFTGPLYPEMSNGTLHHYFVPDGDYEENDDPEKCQMLFQVND-KRKCGLEPDq-dS------LLRDDFVITKRQVE 86
gi 593759271   15 LCQGYFDGPLYPEMSNGTLHHYFVPDGDYEENDDPEKCQLLFRVSD-HRRCSQGEGs-pAssllslTLREEFTVLGRQVE 92
gi 478431071   15 LCRGYFEGPLYPEMSNGTLHHYFVPDGDYEENDDPERCQLLFRVSE-QRRCGTAAAg-eGl-----SLREELTVLGRQVE 87
gi 751998050   36 LCGAVYEGPLLPEMSNGTFHHFFVPDGDYEETEDPEKCQMLFKWID-RRPCPLEEDr-dT------VIREDFIIVKQQIE 107
gi 1041068517  17 agSAAFTGPLQPEISNGTFHHFFVPDGDYEETVDPEQCQMLFKFSD-ALPCAASEEesdA------AVRDDFIISKLQAE 89
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 292630308  105 DAARVLETLGKSISFDLDGEDSYGKYLKREIEQIGEAFTNVEKSLLELESKFKQSQETEQREESEFSSNFIKPVYDVRET 184
gi 301619099   85 DAERVLQSIGKSISYDLDGEESYGKYLGRESSQISESFSTSDKSLTELEVKFKQSQENEKNEAKSINDDFVDMMIHTRGV 164
gi 432861561  112 DAARLLESIGRTVAHDLDGEDSYGKFLQREISQISEAFSSVDKSLLELEVKFKQSQETELREEQQLNGYVVQQVSDIRGA 191
gi 928166096   93 DAGRVLEGLSKSISYDLDGEESYGKYLRRESHQIGDAYSLSDRSLAELESKFRQGQEQAGRPDGRLGDDFLGMLRRTAAL 172
gi 597766313   89 DAARVLEGIARSVALDLDGEESYARYLRRETSQISEAFAASERALLELEGKFAQSRERE--EARRPGDDFAGMAEHARDL 166
gi 410912720   87 DSARVLEGIGKSISYDLDGEDSYGKYLRRETAQISEAFTNSEKSLLELEVKFKQSQESELKEEHRLSDDFLTMVVQTRDV 166
gi 556974703   87 DAGRVLEGIGKSISYDLDGEDSYGKYLRREATQIGEAFSNSDKSLTELEIKFKQSQQNEVKEENRINDDFLDMIIHTREL 166
gi 593759271   93 DAGRVLEGISKSISYDLDGEESYGKYLRRESHQIGDAYSNSDKSLTELESKFKQGQEQDSRQESRLNEDFLGMLVHTRSL 172
gi 478431071   88 DAGRVLEGIGKSISYDLDGEESYSTYLRRESAQISDAYSSSDRSLSELEGKFRQGQEQGGREEARLGDSFLGLLLHARAL 167
gi 751998050  108 DAARVLETLGKSISFDLDGEDSYGKYLKREIEQIGEAFTNVEKSLLELESKFKQSQETEQREESEFSSNFIKPVYDVRET 187
gi 1041068517  90 DAARLLESIGRTVAHDLDGEDSYGKFLRREISQIGDAFSSVDKSLVELEVKFKQSQETELREEQQLSGYVLKQVSDIRGA 169
                         170       180       190
                  ....*....|....*....|....*....|....*...
gi 292630308  185 LQETLDISSGLKDKHELISLIVRNHGSRLSRLKNDYLN 222
gi 301619099  165 LKETLDISMGLRDKHELLSLTIRSHGTRLSRLKNMYLK 202
gi 432861561  192 LRETTDISLGLRDRHELLSLIIRSHGTRLSRLKTEFLt 229
gi 928166096  173 LKDTLAVAAGLGDRYELLALTVRSHGTRLGRLKNEHLK 210
gi 597766313  167 LRETRNAATALGDHHELLTLVVRSHGARLSRLKNEYLK 204
gi 410912720  167 LKETVDISLGLKDKHELLSLIIRSHGTRLSRLKNEYMK 204
gi 556974703  167 LRETLEISTGLKDKHELLSLIIRSHGTRLSRLKNEYLR 204
gi 593759271  173 LKETLDISVGLRDKYELLALTIRSHGTRLGRLKNDYLK 210
gi 478431071  168 LRETRAISSGLRDKHDLLSLTVRSHGARLSRLKNDYLR 205
gi 751998050  188 LQETLDISSGLKDKHELISLIVRSHGSRLSRLKNDYLN 225
gi 1041068517 170 LRETTDISQGLKDRHELLSLIIRSHGTRLSRLKTEYLt 207
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap