Conserved Protein Domain Family
UPF0524

?
pfam15823: UPF0524 
UPF0524 of C3orf70
UPF0524 is a family of proteins found in eukaryotes. Proteins in this family are typically between 183 and 250 amino acids in length. The function is not known.
Statistics
?
PSSM-Id: 318116
View PSSM: pfam15823
Aligned: 10 rows
Threshold Bit Score: 385.691
Threshold Setting Gi: 768910640
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123889165   8 KSEKLDEAQALARSCAG-RPDFLPCDGLSICATHSHGKCFKLHWCCHLGWCHCKYVYQPMTSVCQLPSTAVPVAPSGHTH 86
gi 189042273  11 KSDKLDEAQALAKSCAG-RPDFLPCDGLSICATHSHGKCFKLHWCCYLGWCHCKYVYQPMTNVAQLPSTPVPAAPSDCPD 89
gi 597743507  15 KK---DEAQALARSCAS-RPDFLPCDG-SVCATHTHGKCFRLHWCCHLGWCHCKYVYQPMTSVGKLPSTAIPAAPSFYTD 89
gi 597765634   8 KSEKLDEAQALAKSCAG-RPDFLPCDGLSICATHSHGKCFKLHWCCHLGWCHCKYVYQPMTSVCQLPSTSVPATPSDNTH 86
gi 768910640  11 KSEKLDEAQALAKSCAG-RPDFLPCDGLSICATHSHGKCFKLHWCCHLGWCHCKYVYQPMTNVCRLPSTAVPPTGAEHSN 89
gi 583986810  11 KSEKLDEAQALAKSCAG-RPDFLPCDGLSICATHSHGKCFKLHWCCHLGWCHCKYVYQPMTNVCQLPSTTVPPVGSEYSS 89
gi 301614193  11 KNDKVDEAQALARSCAG-RPDFKPCDGLSICATHSHGKCFRLHWCCHLGWCHCKYVYQPMTPVEQLPSTEIPAEPQDQTN 89
gi 532090785  14 KSEKVDEAQALARSCAArRPDFQPCDGLSICATHSHGKCFKLHWCCHLGWCHCKYVYQPMTPVEQLPSTEIPARPREPTN 93
gi 556987746  11 KNEKVDEAQALARSCAG-RPDFQPCDGLSICATHSHGKCFKLHWCCHLGWCHCRYVYQPMTPVEQLPSTTIPASPSEHMD 89
gi 573897961  11 KSDKLDEAQALAKSCAG-RPDFLPCDGLSICATHSHGKCFKLHWCCHLGWCHCKYVYQPMTNVGQLPSTPVPAAPSDYTN 89
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123889165  87 TMNLSISLAERFLRTAPKFQAPPCPESPKFCVISDLFVDDYMVKRINGKMCYVQR------------------------- 141
gi 189042273  90 TIDLSISLTERFLRISPCFQAPPCPESPKYCNIAELFIDDYIVKRINGKMCYVQR------------------------- 144
gi 597743507  90 TIDLSISLTERFLRIAPCFRPPLYPEYPRYCNIAELFIDDYIVKRINGKMCYVQR------------------------- 144
gi 597765634  87 TMNLSISLTERLLRTASNFKAPPCPESPKFCVISDLFIDDYIVKRINGKMCYVQR------------------------- 141
gi 768910640  90 SIDLSISLAERFLKLAPSYQPPPYLESPKYCVISDLFLDDYVVKRINGKMCYVQR------------------------- 144
gi 583986810  90 TIDLSVSLAERFLKLAPCFKSPPHLESPKYCVIADLFVDDYIVKRINGKMCYVQRpppplpepprpptppppapatptvp 169
gi 301614193  90 TIQISVSLAEHFLKVAPSFQPPYIPESPRYCTISDLFLDNYQVKCINGKMCYVQRqp----------------------- 146
gi 532090785  94 TIQISVSLTEHFLKFASVFQPPLPPDSPRYCMISDLFIDNYQVKCINGKMCYVQKq------------------------ 149
gi 556987746  90 TIQIHISLMEHFLKTAPVFRAPLIPESPRYCTIADLFIDDYQVKYVNGKMCYVQR------------------------- 144
gi 573897961  90 TINLSVSLTERFLKTAPCFQPPPCPESPKYCLISELFIDDYQVKRINGKMCYVQR------------------------- 144
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123889165 142 --------PP-------------------------------------------PPTPNPTHQPQ----------TAAPQP 160
gi 189042273 145 --------PQ-------------------------------------------AHVEPAQMNPI----------QKQHTE 163
gi 597743507 145 --------PV-------------------------------------------PQMEAP-PTPH----------PHAPPP 162
gi 597765634 142 --------PP-------------------------------------------PPMPSPPQQPQ----------ALKTQA 160
gi 768910640 145 --------SPpplpeppqppallppalsksqnlpnppapqppakpaapvqqpsTPPPEQPVQKA----------QNEEK- 205
gi 583986810 170 enpsqaqqPP-------------------------------------------KPIPSTQNAPApvqpvqqvygEHKHP- 205
gi 301614193 147 -------lPP-------------------------------------------PPSHGARPVRE----------HQQEA- 165
gi 532090785 150 --------PA-------------------------------------------PHSHKMSPEEV----------SAHDA- 167
gi 556987746 145 --------QQ-------------------------------------------RQVHEPRPGVA----------SKQAAA 163
gi 573897961 145 --------PS-------------------------------------------PQVPAPLPAQA----------PSQPPV 163
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123889165 161 VPQrsknshqvgptvkqgQAK----------E---------------------KISAPKMDHCSSPSSSEDSGINALGLH 209
gi 189042273 164 DKQ---------------IVE----------E---------------------TVKGPKMGHCSSPSTSEDSGINALGGH 197
gi 597743507 163 LDTrtas--------lhqLDA----------RtgqhsantvtldankghvvmdTVKAPKMDHCSSPSNSDDSGINAGGRH 224
gi 597765634 161 PTQrvhkqva--qvgqtqGKQ----------G---------------------QKAGPKMDHCSSPSSSEDSGINALGLH 207
gi 768910640 206 ------------------RPSp--------lD---------------------KVKGPKMDHCSSPSSSEDSGINALGLH 238
gi 583986810 206 ------------------SPL----------D---------------------KVKGPKMDHCSSPSSSEDSGINALGLH 236
gi 301614193 166 ------------------YQP----------N---------------------EAQGPKLDHCSSPSNSEDSGINAVGVP 196
gi 532090785 168 ------------------LIS----------K---------------------ESNTPKIDHCSSPSSSEDSGINAIGAH 198
gi 556987746 164 VVTk--------------EVS----------E---------------------KAQMPKMDHCSSPSSSEDSGINALGLH 198
gi 573897961 164 QGArpss--------nyqQTMsaaapgvggrE---------------------KASGPKMDHCSSPSSSEDSGINALGLH 214
                        330       340       350       360       370       380       390
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 123889165 210 YM----ESCdeds-cvddDDEEEEDDE-----LSTDGNSSPGSFWDQDECTL-LSPSKSIVEIIEKIETTV 269
gi 189042273 198 FL----ESC---------EEESEEEDE-----LSTDGHSSPGSLWDQDECTL-LSPSKSMVEIIENIETTV 249
gi 597743507 225 YL----ESCeee---teeEEEEEEDDE-----LSEGRVSSRSSLWEQDGCGL-LSPSKSTVEIIENIETTV 282
gi 597765634 208 YM----ESCdedsceddeDEEEEEDDE-----LSTDGDSSPGSLWEQDECTL-LSPSKSMVEIIEKIETTV 268
gi 768910640 239 YL----ESCe--------DESEEEEEEeeedvLSTDGHSSPGSLWDHDDCSL-LSPSKSMIEIIEKIETTV 296
gi 583986810 237 YLesceEES---------EEEEEEDDE-----LSTDGNSSPGSLWDQDDCSL-LSPSKSMIEIIEKIETTV 292
gi 301614193 197 FL----ESC---------DDDTEEGAE-----LSSEEDCSPDSCWGQENCPLvVSPSKTDLEVIETIETTV 249
gi 532090785 199 YV----ESC---------DEDTEEGAE-----LSSEEDYSPESSWEPDECTL-LSPSQSDLEVIETIETTV 250
gi 556987746 199 YL----ESC---------EEESEEEGE-----LSSEEDSSRDSQWEQDDCAI-LSPSDSSVEIIETIETTV 250
gi 573897961 215 YL----ESCded----teDEEEEEDDE-----LSTDEDSSPGSIWDQDECTL-LSPSKSTVEIIEKIETTV 271
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap