Conserved Protein Domain Family
UPF0730

?
pfam15827: UPF0730 
UPF0730 unknown protein family
UPF0730 is a family of proteins found in eukaryotes. Proteins in this family are typically between 51 and 156 amino acids in length.
Statistics
?
PSSM-Id: 318119
View PSSM: pfam15827
Aligned: 2 rows
Threshold Bit Score: 81.6538
Threshold Setting Gi: 0
Created: 3-Aug-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40
                ....*....|....*....|....*....|....*....|....*.
1_pfamImport  1 DCCAEPFSYEELQHYHVVPYGSGNCLYGLGYPSSPPDHSPQLLVYK 46
2_pfamImport  1 DCCAEPFSYEELQHYHVVPYGSGNCLYGLGYPSSPPDHSPQLLVYK 46
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap