Conserved Protein Domain Family
TEX29

?
pfam15839: TEX29 
Testis-expressed sequence 29 protein
TEX29, testis-expressed sequence 29 protein, is a family of proteins found in eukaryotes. Proteins in this family are typically between 39 and 150 amino acids in length.
Statistics
?
PSSM-Id: 318131
View PSSM: pfam15839
Aligned: 6 rows
Threshold Bit Score: 120.251
Threshold Setting Gi: 351699381
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 81884492   13 QLLKTFAVCDISLYDICDYNVTRDQCKELGCCFYKGVCYKKVVPIYVQMFSTLIVLVTGIIIITIIYRIVQEIKRQ 88
gi 81905915   13 HLLKKFAVCDIPLYDICDYNVTRERCRSLDCCFYRGVCYEKAVPIYVQVFFTLIWFVAGAFIIAVIYRVIQGTKKE 88
gi 562862867  13 hllkkfaVCDIPLYDICDYNVSRDRCKELGCCFYKGVCYEKAVPVYVQVFSALIVVIAGAFVITIIYRVIRESRRE 88
gi 731206913  13 HLLQQFAVCDIPLYTICDYNVSRDRCKELGCCFYKSVCYEKAVPVYVHVFSILVTIIAVTFIVVIVYKRVRERRKQ 88
gi 351699381   1 -------VCDIPLHTTCDYNVSRARCKELGCCFYQSICYEKVMPIYVHMFSTLVVIISAALVPFLVHKKIHERRKK 69
gi 940729201  13 QFLRSFAVCDIPLDHICSHNVSRDQCKGLGRCFHRGVCHEKSVSIYVHVFCALILLIAGAFIITMIYRVVQERKEk 88
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap