Conserved Protein Domain Family
ARL17

?
pfam15840: ARL17 
ADP-ribosylation factor-like protein 17
ARL17 is a family of proteins found in primates. Proteins in this family are typically between 82 and 130 amino acids in length. Members of this family are also referred to as NBR2 or neighbor of BRAC1 gene 2.
Statistics
?
PSSM-Id: 318132
View PSSM: pfam15840
Aligned: 4 rows
Threshold Bit Score: 98.2569
Threshold Setting Gi: 355754221
Created: 30-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 6093476      1 MWKGGRSHPFLPCSSRRAGSGGQLDSILPHQSPAWGPWGCKDLSSGVPSFLTSSILWKSAVF 62
gi 93141230   115 MWKGGRSHPFLPHSSRCAGSGGQLDSILPHQSPAWGPWGCKDLSSGFPSFLTSSILWKSAVV 176
gi 355754221   29 MWKGGRSHHFLPRSSACAGS-GQLDSILPHQSPAWGPWGCKDLSSGFPSFLTSSTLWKSAVV 89
gi 1034117754 115 MWKGGRSHPFLPHSSRCAGSGGQLDSILPHQSPAWGPWGCKDLSSSFPSFLTSSILWKSAVq 176
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap