Conserved Protein Domain Family
DUF4724

?
pfam15852: DUF4724 
Domain of unknown function (DUF4724)
This family of proteins is found in mammals. There is a conserved KVKPL sequence motif.
Statistics
?
PSSM-Id: 318137
View PSSM: pfam15852
Aligned: 4 rows
Threshold Bit Score: 125.123
Threshold Setting Gi: 982942413
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 982942413 207 MFTRHTLFRQFAVLADTSFNYVKVKPLFVQSKTNLATVTTSATSvdhSPSVDIKYEDVGSNQISLPLSPQ-VRSENLEEE 285
gi 675667114 479 MFTRHTLFRQFAVLADTSFNYIKVKPLFVQSKTTLMGTASSSHG---TSSIDSKHAVGASDQAFPQLSPR-ETSESPKEE 554
gi 675763758   1 MFTRHTLFRQFAVLADTSFNYIKVKPLLVQSRTTMTAISSSSHC---TSSIDGKHVDVVSDQAALQLSPKgKLSESPKEE 77
gi 859813701 469 MFTRHTLFRQFAMLADTSFNYIKLKPLFVQSKTNLVTGSTSSGSd-hTPLMD-KDMDKVSDQIFFSPLSKgRLSDTPEEE 546
                         90
                 ....*....|.
gi 982942413 286 SQeEKQSTPQN 296
gi 675667114 555 PS-EKLSTHQS 564
gi 675763758  78 SL-EEPSMRQS 87
gi 859813701 547 PL-EKPLIPQN 556
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap