Conserved Protein Domain Family
DUF4727

?
pfam15856: DUF4727 
Domain of unknown function (DUF4727)
This family of proteins is found in vertebrates. There are a number of conserved cysteines, but the domain is not a zinc-finger.
Statistics
?
PSSM-Id: 318140
View PSSM: pfam15856
Aligned: 9 rows
Threshold Bit Score: 386.518
Threshold Setting Gi: 262050614
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 755751208   25 GLLSEDRSCRAPRCCGNLLVLCLFLIWQVQSCWHQVTRTHPSTRKVTKMPPQKWAVPSTRHDTCLRLTPEfFFSPGDFHG 104
gi 532073322   25 GLISQDCSCRDPRCCGNLLVLCLFLIWQVRHYWHHFTRNRLRRRIIIKVPLQKWAMPSMRCEIFFRLAPE-FVSPGDFRG 103
gi 262050614   25 GLLSQDQSCKDPRCCGNLLVSCLFLIWQIQQYWHQFSRTR--KRNVTKVPPQRWTVLSAPQDTFVGMIPE-FFTHGKNRG 101
gi 562843537   25 dLLSQDRSCRDPRCCSNLLVLCLFLIWQVRHSWYQITRTRPRMRSFIKAPLQEWAVPPRTCEALFRLVPAfVCSPGKFRG 104
gi 927126707   25 GLFSKDRSCRDPRCCGNLLVLCLFLIWQARQYWHQVTRTHRSMRKSTKVPPQKWAVPSMRHDPCFGLTPEfFFSPGKFRC 104
gi 982982754   25 GLLSEDRSCRDPRCCGNLLVLCLFLIWQVRHYWHQVTRTHRSMRKFIKVPLQKWAVPSMRHDTCIRLTPEfFLSPGKFRG 104
gi 345776802   25 GLLSEDHSCRDPRCCGNLLVLCLFLIWQVQHYWQQITRTHPSMKKVIKVPLQKWAVPSTRHDTCFRMTRE-FFSLSDFSG 103
gi 332231341   25 GLLSQDHSCRDPQCCGNLLVLCLFLVWQVRHYWHQVTRTRFSTRNVIQVPMQKWAVPSMRCETVFKLTPE-FFSPGKSRG 103
gi 831214450   25 GLFSQDHSCKDPRCYGNLLVLCLFLIWQVRHYWHHVTRTCPSRRNVTKMPLQKWAVSSMRQETFFRPTS------GKFRG 98
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 755751208  105 LDAHVQQRSQKKMYEHRRSLQESW-TRYLVSWQHPCQDPPWDFHTPSDPIFCTTSFSSTCMLPQNSAREAQPVPWCLSEE 183
gi 532073322  104 CDAHVQQWVQKQRWRYRKSLLESW-TQNLFSSQNLLQDSSWGAHTSHDPIFCISSFSSTCPLSQDSSWETCQVSWCLKGS 182
gi 262050614  102 LDVHIQQWMQKRRWGYQKTVRQQWdTQYLLSLQKPCQDLPWDVHTSTEPIFCTSSFSNTCLLPQDSSWEAWQLPWYPRDS 181
gi 562843537  105 PDAHVQKWAREQRWGYWRDLQDSW-DPSLLSLD-PYQDSPWGVHVPSEPIFCTTSFSSNSLVPLESSWEAWQVPLCVRDD 182
gi 927126707  105 LDSHAQQWAQKKRGEYWRSLQESW-TQYLLSCQHSCQGLLWDAHTPSEHIFCTTSFSNTCVLPQGSSWEAWQGPWCHSDD 183
gi 982982754  105 LDAHAQQWARRKSREYWRSLEESW-TQYLLSCQHPCHHLLWDAYTSSDHIFCTTSFPSTSMLPRDCSWEAWQVPWCCSDD 183
gi 345776802  104 LDAHVQQWAQKKRHEYRRSLQESW-NQYLLSWQHPRQGSSWDFCTPFEPFFCTTSFSSTCMLSQDSSWEAWQVPWCLSDE 182
gi 332231341  104 LDS--QQCTQRQRWGYRRSLQESW-AQKLLSPQHSCPGPPSGVHTHSEPIFCTTSISNTCLLPQDSSWKAWQVPWCLCDG 180
gi 831214450   99 LDAPVQNWAQKERWGYRMNLQESW-AQYLLSPQHQCQGPRCSARTHSEPTLCTTSFSNTCLLPQGSSWKAWQVPWCLSDG 177
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 755751208  184 QSHlicrppsPSLDMYQRMEQLFVYSQEELVPLELVVSMRSHLTPMTLATSLSNLLSSQRVHFC 247
gi 532073322  183 QTH-------SALDTCQRIGRLLVHSQEKLVPLEHVLSRKICSPPMTFVISLPKLPSAQRLQFC 239
gi 262050614  182 QAH-------PSLAICQRTEQLLDPSHT-LVPAEPV-SLRY--TSTTLAFSLPNFPPAQSPNVC 234
gi 562843537  183 WTH-------PALGMCQRMEQLLVHSQERSVPQEPVISMRFHHTSTTSAISLPKFPSAQSPQFP 239
gi 927126707  184 QTHlic----kpLDMCQRMEQLLVQSQEEVVPVDHTVSMRSHPTSMT---SLPHLPSAQRLQFC 240
gi 982982754  184 QTHlickpqpPALDRCQRMEQLLVHPQEELAPLEHIVSMRCHPTSMT---PLPNLPSAQSLPFC 244
gi 345776802  183 QTHlickplsSPLDRYQRMEQLLVHSQEELMPLESVVSMRSHLKPMILATSLSSLPSSQRLQFs 246
gi 332231341  181 QTH-------PALDMCQEMEQLLLHSQERLVSLEPVISMRSRPTSMTLTTSLPNLLSAQRLQFC 237
gi 831214450  178 HTH-------PVLDMSHKVEQLVVHSQKNLMELEPVISMRSGPTSLTLTTSLPNLPSAQRLQFP 234
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap