Conserved Protein Domain Family
JMY

?
pfam15871: JMY 
Junction-mediating and -regulatory protein
JMY, Junction-mediating and -regulatory protein is also a WASP homolog-associated protein with actin, membranes and microtubules. This middle region is the coiled-coil region that putatively binds microtubules to the scaffold. This ability to interact with microtubules plays a role in membrane tubulation.
Statistics
?
PSSM-Id: 318152
View PSSM: pfam15871
Aligned: 17 rows
Threshold Bit Score: 436.385
Threshold Setting Gi: 1005943924
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82185655  123 WAGLFSFQDLRAAHLQLCAVNADLEPCLPALPE-------EQTGV--------WSVLFg-VPEMSARDTDALCFQLQVYL 186
gi 47086107  123 WAGLFSFQDLRAAHLQLCAVNADLEPCLPALPE-------EQTGV--------WSVLFg-VPEMSARDTDALCFQLQVYL 186
gi 762107606  63 RTGIFSFHELEAIHNLLCHVHPALGPHLPVLPE-------EPRSL--------WTYL---GYEECNTDYSHVCYQIEEYL 124
gi 118095845  59 WAGLFSAPALRGVHRQLAAVCPRLEPALPALPPal---pgASGGL--------WAVLFpsGPAPSEAEVAELCRQLERYL 127
gi 194039576  80 WAGLLSASGLRGAHRQLAALWPPLEPCFPQLPPeldagggGAWGLgr----glWTLVWpaRAGPGEAALQELCGQLERYL 155
gi 126273657  90 WAGLFSATELQGVHRQLAAVSPQLEACFPALPPe------VGPSL--------WTLLFpaRPAPDEAVLQERCGQLELYL 155
gi 471367993 232 WAGLFSFQDLRAVHQQLCSVNSQLEPCLPVFPE-------EPSGM--------WTVLFggAPEMTEQEIDTLCYQLQVYL 296
gi 332224818 229 WAGLFSFQDLRAVHQQLCSVNSQLEPCLPVFPE-------EPSGM--------WTVLFggAPEMTEQEIDTLCYQLQVYL 293
gi 195539466  67 WAGALSAAGFRGAHRQLAALWPALERCFPPLPPeldaasgAGWGLgrglwalvWALVWpaPANPGDAALQDLCRQLEHYL 146
gi 768958726 160 WAGLFSVQDLRAAHLQLCAVNSDLEPCLPSFPE-------EQSGV--------WTVLFg-APGVSQRETEALCYQLQVYL 223
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82185655  187 GHALDTCGWRILSQVLFP-DSEDAEEYYESLSELRQKGYEDALQRAKRRLQQLLEQQRAVERMVELLQLYSEQDEAYGEL 265
gi 47086107  187 GHALDTCGWRILSQVLFP-DSEDAEEYYESLSELRQKGYEDALQRAKRRLQQLLEQQRAVERMVELLQLYSEQDEAYGEL 265
gi 762107606 125 CYSLEICKEKLLMSTLFEyEEHSAEEYFENISELRRQGYDEEINKVEEELKNVIFLRTNASHMTDMKDVYKSEDKAVFKL 204
gi 118095845 128 GWALELCGGRVLLDVLFAaDRRD-DeyFESLHEFRGKALHGHLARAKEALRRVLQQHKNADTMVALMKVYEEEDEAYQDL 206
gi 194039576 156 GQAADGCGGSAVRDALFPaDGCAAD--CESLREFRERALRARRDEAGSRLRQLLRGHKKANTMVALMEVYQEEDEAYQEL 233
gi 126273657 156 SAAADRCGARMLLDSLFSaDTEPGDeyFENLHEFRKKSLQGHVARAKERLQRIIHEHKNAEKMMDLMKVYEEEDEAYQEL 235
gi 471367993 297 GHGLDTCGWKILSQVLFT-ETDDPEeyYESLSELRQKGYEEVLQRARKRIQELLDKHKNTESMVELLELYQREDEAYSSL 375
gi 332224818 294 GHGLDTCGWKILSQVLFT-ETDDPEeyYESLSELRQKGYEEVLQRARKRIQELLDKHKNIESMVELLDLYQMEDEAYSSL 372
gi 195539466 147 GLAADGCGGATVRDVLFPaPGDSAD--CEGLSEFRERMLRARLDQTVARLRQLLQDHRKANTMVTLMKVYQEEDEVYQEL 224
gi 768958726 224 GHALDTCGWKILSQVLFS-EGDDTEeyYESLSELRQNGYEDAQERAKRRLQEVLDRHKAMDNMVELLQVYTQEDEAYGEL 302
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82185655  266 VEATTELYHYLLQPFRDMRELAMLRRQQIKISLETERLGPRRVESLRREDEDWQRKAHTAVLSIQDLTVKYFETTARAQK 345
gi 47086107  266 VEATTELYHYLLQPFRDMRELAMLRRQQIKISLETERLGPRRVESLRREDEDWQRKAHTAVLSIQDLTVKYFETTARAQK 345
gi 762107606 205 NIALASLYNYLLQPFLDVRELAYSRVMEAKEQLENPDVGARVKREYGEMFTEWQAHYEEALDNIQKYYIEYYTRTSKIYE 284
gi 118095845 207 VTMATQFYQYLLQPFRDMRELATLCKLEILKSLQYDNLGPKRVAALQKDAEEWTKRAESAVCSIQDITVKYFKETVKALS 286
gi 194039576 234 VTVATMFFQYLLQPFRDMRELATSCKLAILKSLDEDDLGPKRIAALQKEAQEWTRRAEEAVVSIQDITVNYFEETVEALA 313
gi 126273657 236 VTVATKFYQYLLQPFRDMRELATLYKLEISKSIDFDELGPKRIEALQKEAKKWTKRAEEAVTSIQDITVNYFKETVNALV 315
gi 471367993 376 AEATTELYQYLLQPFRDMRELAMLRRQQIKISMENDYLGPRRIESLQKEDADWQRKAHMAVLSIQDLTVKYFEITAKAQK 455
gi 332224818 373 AEATTELYQYLLQPFRDMRELAMLRRQQIKISMENDYLGPRRIESLQKEDADWQRKAHMAVLSIQDLTVKYFEITAKAQK 452
gi 195539466 225 VTMATTFFQYLLQPFRDMREVATSCKLGILKSLEEDELGPKRVAALQKEASEWTRRAEEAVVSIQDITVNYFKETVTALT 304
gi 768958726 303 LEATTQLYHYLLQPFRDMREVAMLHRQQIKISLETERLGPRRVEGLRKEDEEWQKKAHAAVLSIQDLTVKFFEATTRAQK 382
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82185655  346 VMYERMRADQRKFGKAAWG-AAVERMERLQYAVSKETLQLMRAKEICLEQRKHGLREEMQGLQGGEDAMARLDQLEALYY 424
gi 47086107  346 VMYERMRADQRKFGKAAWG-AAVERMERLQYAVSKETLQLMRAKEICLEQRKHGLREEMQGLQGGEDAMARLDQLEALYY 424
gi 762107606 285 GMLKRMREDQTKFGKTAFQlIGAERFFRIKEDHSLECLQLLNNEKKLYVQERDKVKEEIACVEDKPGALTELDRLEGVVF 364
gi 118095845 287 AMHKQMEQDQERFGKATWA-SALPRLENLKYMLAKETLQHLRARELCLKQKRAAIQKNMENLNEQEENVTVAEELEIYYY 365
gi 194039576 314 GMQKQMAQDEKRFGQAAWA-TATPRLEKLKLMLARETLQLMRAKELCLNHRRAEIQgKMEDLPEQERKKNVVDALEIQYY 392
gi 126273657 316 VMQKQMEQDEKRFGQATWA-LAAPRLEKLKYMLARESLQHKRAKELCLNQKRVEIRKKVEGLSEVEKNIDVVDELEIQYY 394
gi 471367993 456 AVYDRMRADQKKFGKASWA-AAAERMEKLQYAVSKETLQLMRAKEICLEQRKHALKEEMQSLQGGTEAIARLDQLEADYY 534
gi 332224818 453 AVYDRMRADQKKFGKASWA-AAAERMEKLQYAVSKETLQMMRAKEICLEQRKHALKEEMQSLRGGTEAIARLDQLEADYY 531
gi 195539466 305 GMQKQMEQDQRRFGQAAWA-TAMPRLENLKLMLARETLQLMRAKELCLKHRQAEIQRKVEDLPDQGKNVGVVDELEIQYY 383
gi 768958726 383 ALYERMRADQKKFGKSTWA-AAVERIEQLQYAVSKETLQLMRAKEICLEQKKHALKEEMQSLKGGEDAMLRLDQMEALYY 461
                        330       340       350       360       370
                 ....*....|....*....|....*....|....*....|....*....|..
gi 82185655  425 ELQLQLYEIQFEILKNEELLLTAQLQSLRRQMSERQEEVVYYDTFESPDAMK 476
gi 47086107  425 ELQLQLYEIQFEILKNEELLLTAQLQSLRRQMSERQEEVVYYDTFESPDAMK 476
gi 762107606 365 NWQIKVQQQQMAILDEEERLIRTQMEAITNQIKADEDVPIFYDAVEDIEELS 416
gi 118095845 366 ETQLELYNVQLDVLKHEEMLLIVQLDTLRRQIKEKQDEVVYYDTCENPEELK 417
gi 194039576 393 EVQLELYEVKFEILKYEEILLVTQLDSTKRLIKDKQDEVVYYDSCESPEELK 444
gi 126273657 395 DVQLELYEVQLEILKFEEMLLIIELDTIRRLIKEKQDEVVYYDTCENPEELK 446
gi 471367993 535 DLQLQLYEVQFEILKCEELLLTSQLESIKRLVSEKRDEVVYYDTYESMEAMl 586
gi 332224818 532 DLQLQLYEVQFEILKCEELLLTAQLESIKRLISEKRDEVVYYDTYESMEAMl 583
gi 195539466 384 ETQLELYDVKLEILRNEETILVTRLDSVKRLIAEKQAEVVYYDPCESPEELK 435
gi 768958726 462 KLQLQLYDIQAEVLQCEELLLTAQLQSLRRQMTEHQDEVVYYDAFESPDAMK 513
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap