Conserved Protein Domain Family
DUF4731

?
pfam15875: DUF4731 
Domain of unknown function (DUF4731)
This family of proteins is found in eukaryotes. Proteins in this family are typically between 37 and 78 amino acids in length.
Statistics
?
PSSM-Id: 318155
View PSSM: pfam15875
Aligned: 12 rows
Threshold Bit Score: 99.0905
Threshold Setting Gi: 218551781
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 218551782  3 PqESHVHYSRWEDGSRDGVSLGAVSSTEEASRCRRISQRLCTGKLGIAMKVLGGVALFWIIFILGYLTGYYVHKC 77
7_pfamImport  1 P-ESGVQYSRWDGSSWDEVSVAAVSSTGEASSWKRLSQKLCSGKLGTAMKLLGGVALFWTVFILGYVTGYFVHKC 74
4_pfamImport  1 PqESSIRYSRWENSHPDEVHVASGPSTEEASGWQRVSQKLCSGKLGIAMKVLGGVALFWVVFILGYVTGYYVHKC 75
2_pfamImport  1 TqESGVQYSRWDDRSRDEVHVVAGSGTEEAWSWQRVSRKLCSGKLGIAMKVLGGVALFWVVFILGYLTGYYVHKC 75
1_pfamImport  1 PqDSSVQYSRWNNSSRDEVSVAPVSSTEEASGYARISRKLCSGKLGISLKVLGGVTLFWAVFILGYLTGYYMHKC 75
3_pfamImport  1 SqESGVHYSRWDNSSRDEVSMTAMSSTEEASCYRRLSQKLCSGKLGIAMKVLGGVALFWIVFILGYVTGYYVHKC 75
8_pfamImport  1 PqDPSVQYSRW-----DEVSVGAASSPEEAPCCDRLSRKLCSGRLGVTMRMLGGVALFWVIFILGYVAGYLVHKC 70
6_pfamImport  1 PqDSGIQYSRWDGGSRDAVHVAAVGSTGEASSWERISRKLCSGKLGISMKVLGGLALFWVVFILGYITGYYVHKC 75
5_pfamImport  1 P-ESRVHYSRWEDNSQDEVSVAAVSST-EASGCKAVFRKLCTGKLGIAVKVLGGVALFWAIFILGYVTGYYVHKC 73
9_pfamImport  1 PqETDVQYSRWNENNQDEVSISV--SATETSSYSRLYSKMCTGKMGIAVKVIGGIAAFWIIFIIGYVTGYYVHKC 73
gi 218551781  3 SnGASVQYNRW---SEDNITLQEPQSRSRLLG---IYNRVFTGRLVIMFKIAASLTVMVVMYIAGYITGFYVHQC 71
gi 573908825  3 PqDTDVRYTSWNESTRDDVRMTGSSSASGVLAC---YDKMFTGNLGIAVKVAAVLVFMIVIYLIGYVSGYYVHKC 74
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap