Conserved Protein Domain Family
DUF4734

?
pfam15881: DUF4734 
Domain of unknown function (DUF4734)
This domain family is found in species of Drosophila, and is approximately 90 amino acids in length. The family is found in association with pfam07707.
Statistics
?
PSSM-Id: 318160
View PSSM: pfam15881
Aligned: 32 rows
Threshold Bit Score: 87.3342
Threshold Setting Gi: 1037077475
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122114402 330 NPEVEYKIDESISRITSRMYEDALEG---NDAQSEEYASDSGQRNWICDSLCSYYHGVGCPNTREIRFKHFEDYLSELQQ 406
gi 121994094 263 FPGVQALVAKGLEDAVALKKKPCDSs---SNNEGNKKDDGPLPREWIADPACLYHHKCHCQRFVYPTYEVFKQYLARIIS 339
gi 195392208 307 NPVVQSAINVGLSYTVTQHFMNSDSG-----LQEPLQMQQAQQREWIIDDIAPHHHMYKCPYWQYLNYELFNIYLEQVIT 381
gi 195444450 302 NPEILNMINLGLSYSVTCEFMDKH-----SPLAEPLRMQQAQPRQWIFDETASHHHQYECPNWLYLDFKLFNQFLFRIIS 376
gi 968105983 429 NNIVKAMLWQACLFGEAACAYKENPDchdNVIVGKYSQIKDVERFWAYCQGVPHHHDIRCPRFRQLTYGTFKLFLNRLQS 508
gi 195109899 299 EPVIQDALNAGLSYSVTQHFVHSD-----SPLQKPLELNTEHQREWIIDRSASHHHLYNCPNWTYLDYNAFTLYMAQIIQ 373
gi 198475237 390 SPDFQDWLFEKIKESLAISASMESARn--AKLIEMPNIE-ELERSWVYC-GVPHHHDSRCPNYRQLNYRTFKLFLQRLQQ 465
gi 968054145 436 SHTIRALLWRGLCASHAMLAKRKDPEladDPLIMRIMLIKDFDRKWGFCPGIPHHHAPDCCRFSKLSFKMFLKFLNFLHD 515
gi 195347624 378 TPGVQRLIAAGLEDAITLKSKPCFSGa-aGHRQRKPQEETLMGRDWIVDTECSHHHKSHCEQFVYPTYDEFKKYLAKIIC 456
gi 195131211 361 SQGVQALLEKGLEEALALRYKk-------ARARNSSNMEIPLPRDWVADPECRHHHKCHCERFVYPTYDVFKDYLARIIR 433

                 ....*..
gi 122114402 407 CSKDHWS 413
gi 121994094 340 CAPYYWR 346
gi 195392208 382 AGPHFYK 388
gi 195444450 377 EGSAYVN 383
gi 968105983 509 DAHSYMD 515
gi 195109899 374 AKNLHfh 380
gi 198475237 466 QSETYME 472
gi 968054145 516 DAKKYMT 522
gi 195347624 457 CAPNCWR 463
gi 195131211 434 CAPNYWR 440
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap