Conserved Protein Domain Family
PL48

?
pfam15903: PL48 
Filopodia upregulated, FAM65
PL48 is associated with cytotrophoblast and lineage-specific HL-60 cell differentiation. The N-terminal part of the family is found to induce the formation of filopodia. It is found in vertebrates.
Statistics
?
PSSM-Id: 318175
View PSSM: pfam15903
Aligned: 16 rows
Threshold Bit Score: 447.268
Threshold Setting Gi: 597790429
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158563885   17 VSRSQSFAGVLGSQErgPRNFTVFSPPGPQRKPLvlsRVSRMFSVAH---PAPKVPQPERLDLVYAALKRGLTAYLEVHQ 93
gi 123915606   16 ITRSQSFAGVNSYDKs-YRSLSVFSTPGCVRKTPs--RASRMFTLSTk-sPPPKVPQPERLDEVYEALKRGLQSYLQVHQ 91
gi 768954155   16 angSLSFTAFSS-PT--GRQWPASVQSSFRSKTRtghRSARMHPWSSredRAVWPLQLHDVDAVFQVLLRGLREILESQQ 92
gi 765169274   31 ITRSQSFTGVNSQDKl-YRNLAVFSTPGLSRKPs---RASRMFTMSTksnAPPKVPQPERLDEIYEALKKGLQSYLHLCQ 106
gi 597790429   16 VQRSRSFTGVNTLSS--R-RRLSSARGSLRTKAg---KSPRIPSSARmvgG--WGQQPEQVDRIFQALRKGLKEYLEGHQ 87
gi 765119917   16 lQRSRSFTGGFSSLT--GRQR------SLRTRVTskgKTPKMQLYSArgpGAIWSLQPEKVDGVFKALREGLKEYLEVHQ 87
gi 734632776   31 ITRSQSFTGVNTYDKpy-rNLSVFSTPGLNRKPs---RASRMFTMSTksnPPPKVPQPERLDQVYEALKKGLQSYLQVYQ 106
gi 620947653   31 VSRSQSFAGVVSAQErgPRSLPVFSPPIPPRKPPavsRVSRMFSMAHk-tPPPKVPQPERLDQVYEALKRGLTAYLEVHQ 109
gi 765135504   49 IIRSQSFAGFSTLQErrSRCNSFMGNSAVPKKPQs--KPKKPHLSGHkggSSSREPQPKRLEEVYNALKQGLDEYLEVHQ 126
gi 688561987   16 VQRSRSFTGVNT-LG--GRRRLSSARSSLRSKAVt-gKSPRIP-SNSragSSVWGQQPEQVDRIFQALRKGLKDYLESHQ 90
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158563885   94 QEQEKLQRQIKESKRNSRLGFLYDLDKQVKSIERFLRRLEFHASKIDELYEAYCVQRRLRDGAYNMVRAYsTGSPGSREA 173
gi 123915606   92 MELDGLNRQMKESKRNSRLGFLYELDKQVKVIERFMRRLEFHLSKIDELYEAYCMQRRLRDGADKMVKAY-TASPGSREA 170
gi 768954155   93 GEMDFLVSQQRDTKRDSRLAFIYDLEKEIRALERAIRRVEFQLSKVEELYELYCLQWRLCQGVVNMKKAF-ARSPPTRAC 171
gi 765169274  107 KDLDGINRQIKKSKRNSRLGFLYEQDKQVKVMERFIRRLEFHLSKVEEHHETYCLVRRLRDGADKMIKAY-TASPGSKEA 185
gi 597790429   88 TELDFLSSQQRDTKRNSRLGFFYDLEKEIRALERYIRRLEFHISKVK--------------------------------- 134
gi 765119917   88 AEMELLSSQQRETKRNSRLAFLYDLEKEIRALERYIRRLEFHISKVEELYETYCIQWRLCQGAHNMKRAF-SLSPSTRAS 166
gi 734632776  107 MDLDNLSKQMKESKRNSRLGFLYELDKQVKVTERYIRRLEFHLSKIDELYEAYCLQRRLRDGADKMVKAY-TASPGSKEA 185
gi 620947653  110 LEQEKLNIQIRESKRNSRLGFVYDLDK------------------IDELYEGYCIQRRLRDGAQNMVRAYsTGSPGSREA 171
gi 765135504  127 TELDKLMCLMKDMKRNSRLGVLYDLDKQIKSIERYMRRLEFHISKVDELYEAFCIQSRLRDGASRMKQAF-SSSPSTKGT 205
gi 688561987   91 TELDFLSSQQRDTKRNSRLAFFYDLEKEIRALERYIRRLEFQISKVEELYESYCIQWRLCQGALNMKRAF-SLSPSSRQS 169
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158563885  174 RDSLAEATRGHREYTESMCLLENELEAQLGEFHLRMKGLAGFARLCVGDQYEICMKYGRQRWKLRGRIESSGKQVWDSEE 253
gi 123915606  171 RESLSEANKSFKEYTENMCMLESELENQLGEFHIKMKGLAGFARLCAGDQYEIFMKYGRQRWKLRGRIEINGKQVWDSEE 250
gi 768954155  172 RESLLELSRSHRHSLQDISEMERELEILLGELHIKMKGLIGFARLCPGDQYEVTVQLGRQRWRIRGRIKSDDTQSWEEEH 251
gi 765169274  186 KESLAEANKSYKEYTERMCVLENELESQLGEFHIRMKGLAGFARLCTGDQYEVLLKYGRQRWKLRGQMEMNDKQVWDGEK 265
gi 597790429  135 --------------LIDMCAMEGELEILLGELQIKMKGLIGFARLCPGDQYEVLIRLGRQRWRIRGRIQTDDRQLWDEEE 200
gi 765119917  167 RESLLELSRNHRTSLQDMSAIEAELEILLGELHIKMKGLIGFARLCPGDQYEVVVRLGRQRWRIRGRIVSDDSQSWDEEE 246
gi 734632776  186 RESLTEANKGYKEYTENMCVLESELENQLGEFHIKMKGLAGFARLCAGDQYEIFMKYGRQRWKLRGRIEINAKQVWDSED 265
gi 620947653  172 RDSLAEASRGHREYTESMCLLESELEGQLGEFHIKMKGLAGFARLCAGDQYEICMKYGRQRWKLRGRIEGSGKQVWDSEE 251
gi 765135504  206 KESIAEVNRRYKEYTENMSTFEVELENLLGEFHIKMKGLAGFARLCPGDQYEIFMRYGRQRWKLKGRIEVNSRQSWDGDE 285
gi 688561987  170 RESLLELNRNHRHSLEDMSAMEAELEILLGELHIKMKGLIGFARLCPGDQYEVLIRLGRQRWRIRGRIQTDDRQMWDEEE 249
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158563885  254 TVFLPLLTEFLSIKVTELKGLANhVVVGSVSCETKDLFAALPQVVAVDINDLGTIKLSLEVI-WSPFDKDDQPSAASTVN 332
gi 123915606  251 MVFLPLITEFLSIKVTELKSLANhVVVGSVSCETKDLFAALPQTVAVDINDLGTIKLSLEVT-WNPFDKDDQSSSASTVN 329
gi 768954155  252 MVFLPHIHRNFEIKVMELKGLSW-LLVGMVTCASADFFVSKPQLMLVDITELGTIKLQLEIA-WNPFDSGE-KMKRLSLS 328
gi 765169274  266 MLFVPLIGEFLSVKVTELKSLANhVVVGNVSCDMKDLFAPLPQMVAVDINDLGTIKLSLEVN-WNPFDTEEPGGPISPMI 344
gi 597790429  201 MAFLPHIHENFEIKL---------------------------------------IKLFLCFCvFSPFDSGEVKPVMSSAS 241
gi 765119917  247 Ipfdsterfrpqsisrtsvssrkssiyswtapstpsftekyfmsmvrelqdeegslpsllpkghhsrggvsllsylsnpp 326
gi 734632776  266 MVFLPLISEFLSVKVTELKSLANhVVVGSVSCETKDLFAALPQTVAVDINDLGTIKLSLEVT-WNPFDKDDQGSLSSTVN 344
gi 620947653  252 MVFLPLLTEFLSIKVTELKSLANhVVVGSVACETRDLFAARPQVVAVDINDLGTIKLSLEVT-WNPFDKDDQPSAASTVT 330
gi 765135504  286 MIFMPLISDLINIKVTELKGLAThMLVGSVICETKELFTAMPQVVAVDVNDLGTIKLNLEVT-WYPFDVEDLTLSSGNLS 364
gi 688561987  250 MVFLPHIHGNFEIKVTEVKGLSS-ILVGMVTCRSADFFTARPQMMVVDITELGTIKLQLEVV-WNPFDSTEVRPLTASAS 327
                         330       340       350
                  ....*....|....*....|....*....|....*
gi 158563885  333 KASTVTKRFST-Y-SQSPPDTPSLREQAFYNMLRR 365
gi 123915606  330 KAPTVNKRFST-Y-NQSPPDTPSLREQAFYNMLRR 362
gi 768954155  329 RLSVSARRNPL-H-SRTAGHSPSFTEKYFLSMARR 361
gi 765169274  345 KPTHDSSRFSI-HvNPLPPDATSPPEQRFpklipn 378
gi 597790429  242 RQSVHSRKGSV-Y-SWTPPNTPSFTEKYFLSMMRQ 274
gi 765119917  327 hgpqtprklslsssnteptglagssphlllgdgte 361
gi 734632776  345 KAPTVNKRFSTiF-NQSPPDTPSLREQAFYNMLRr 378
gi 620947653  331 KASTVSKRLSA-Y-SQSPPDTPSLREQAFYNMLRR 363
gi 765135504  365 KATALQRRVSV-Y-SQGTPETPTFQDNSFFstlpd 397
gi 688561987  328 RQSIHSRKGSV-Y-SWTPPNTPSFTEKYFLSMMRQ 360
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap