Conserved Protein Domain Family
LIP1

?
pfam15904: LIP1 
LKB1 serine/threonine kinase interacting protein 1
LIP1 is a protein found in eukaryotes. It represents the N-terminus of a leucine-rich-repeat protein that is implicated in Peutz-Jeghers syndrome. LIP1 interacts with the TGF-beta-regulated transcription factor SMAD4 to form a LKB1-LIP1-SMAD4 ternary complex. Mutations in SMAD4 lead to juvenile polyposis, suggesting a mechanistic link between these two diseases.
Statistics
?
PSSM-Id: 318176
View PSSM: pfam15904
Aligned: 9 rows
Threshold Bit Score: 113.659
Threshold Setting Gi: 441668940
Created: 30-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82241475     6 AGQSRVVHRLATLLRNNGDSVLDGSSTLTLQVGCLQHLTQLFERHLLSR-THQHGFLALPSHPADTASLLEVQFLFDMLQ 84
gi 82231237     7 AAAEPLVSGLARLLQDTGDLVLDGSSTLTLLTPTLQHLTRVFEQHLGSR-NQHRGFVALPSHPAETTAILQAQFLFDMLQ 85
gi 795610821    4 AQRDSLVWKLAGLLRESGDVVLSGCSTLSLLTPTLQQLNHVFELHLGPWgPGQTGFVALPSHPADSPVILQLQFLFDVLQ 83
gi 964116867    1 -mdpqkITELANLLRQNGDKILSSEFTLTLSGSLLRALNDSFTLIADTEvSHDQGFQVVKPINAKSSVFPDLQLLHDFVQ 79
gi 637248884    5 apkeIMLKSLAQLLQDSGDLILDGTSTLTLFTSTLQILTEIFEQHLLPR-NQNHGFIALSSHPAETSAILQAQFLFDVLQ 83
gi 768923646    6 SSQCPLVHSLAKLLRNDGDLVLDGSSTLTLTASSLQQLTRMFEQYLLPR-SKQHGFLALPSHPADTASLLQLQFLFDVLQ 84
gi 765113701    6 SGQSSLVHSLATLLRNNGDVVLDGSSTLTLPAASLQQLTRLFEQHLLPR-SHQHGFLALPSHPADTVSLLELQFLFDILQ 84
gi 441668940    4 AQRDSLVCKLAGLLRESGDVVLSGCSTLSLLTPTLQQLNHVFELHLGPWgPGQTGFVALPSPPAHSPvixqlgfvvfsll 83
gi 573898055    6 SGGSTLVHSLASLLRNNGDSVLDGTSTLSLMASSLQHLTRLFEQYLLSR-THQHGFLALPSHPADTASLLQVQFLFDMLQ 84
                          90
                  ....*....|.
gi 82241475    85 KTVSLKLVNPP 95
gi 82231237    86 KTHSLKLIHVP 96
gi 795610821   84 KTLSLKLVHVp 94
gi 964116867   80 KTTLLKLTHFP 90
gi 637248884   84 KTLSLKLIHVP 94
gi 768923646   85 KTISLKlinpp 95
gi 765113701   85 KTVSLKLINPP 95
gi 441668940   84 ptrgwgxglcl 94
gi 573898055   85 KTISLKarlac 95
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap