Conserved Protein Domain Family
HMMR_C

?
pfam15908: HMMR_C 
Hyaluronan mediated motility receptor C-terminal
HMMR_C is the C-terminal region of eukaryotic hyaluronan-mediated motility receptor proteins. The protein is functionally associated with BRCA1 and thus predicted to be a common, low-penetrance breast cancer candidate.
Statistics
?
PSSM-Id: 318180
View PSSM: pfam15908
Aligned: 7 rows
Threshold Bit Score: 147.766
Threshold Setting Gi: 348041329
Created: 15-Apr-2017
Updated: 23-May-2017
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 145559482  552 RKQLEDEEGRKAEKENTtaELTEEINKWRLLYEELYNKTKPFQLQLDAFEVEKQALLNEHGAAQEQLNKIRDSYAKLLGH 631
gi 611974553  565 NKQLVMEETRKTREKNM--EFTEDVKKWRLLYEELYNKTKPFEQQLDAFEAEKRALLNEHGATQEELNKLSESYAKLLGH 642
gi 301612882 1011 RTQEEEMELLRKESEKNqqDA-MEANKWRALYEELQNKVRPFQQQLDAFEAEKNALLNENGAAQDELNKLSEAYAKLLGH 1089
gi 348041329  681 TLqWEMEEQRQ-DLQRQvdQAQE--KRWEKVR--IY-HLFP-QEQLDAFAAERNALLSENGANQEELNKLSDAYARLLGH 753
gi 528499892  755 HRqLAE-----ARLQSTs---dSETEHWRNLYEELYAKVKPFQEQLDRFAAERSALLNEKGATQAELNKLADAYANLMGH 826
gi 768937797  855 rqdlqrqvdqaqEKS----SPNSEMEHWRKQYEELFAKVRPFQEQLDAFAAERNALLSENGANQEELNKLSDAYARLLGH 930
gi 733908644  567 KKkSEVEKSRKTIHEDMtsSLKEEIKTWRNLYEELHNKTKPFQQQLDAFEAEKNALLNEQGAAQEELNKLSEAYAKLLGH 646
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 145559482  632 QNLKQKIKHVVKLKDENSQLKSEVSKLRCQLAKKKQSETKLQEELNKVLGIKHFDPSKAFHH--ESKENFALKTPLKEG 708
gi 611974553  643 QNQKQKIKHVMKLKEENNQLKLEVSKLRSQLAKEKQVGKKLQEQINEAKGFKRFDPSKAFQH--ESKENFSPKVPLKEG 719
gi 301612882 1090 QNQKQKIKHVMKLKIENSELKQEVSKLRAQLAKEKQVEKQLQAHLNEIQGVKRFDPSKAFRH--DVKENVMPKAPLREG 1166
gi 348041329  754 QNQKQKIKHVMKLKDENTSLKQELSKLRSQVSRLKSDQEQLKSMLPGA-PRRRFDPSKAFQHnkENREN-EKNEPLREG 830
gi 528499892  827 QNQRQKIKHMVKLKEENLELKQEVSKLRSQVGKQKQELDRLKSSe----TTRRFDPSKAFKH--ELKENqKPSSALTQG 899
gi 768937797  931 QNQKQKIKHVMKLKDENTSLKQELSKLRSQVSRLKSDQEQLKSMLPGA-PRRRFDPSKAFQHnkENREN-EKNEPLREG 1007
gi 733908644  647 QNQKQKIKHVMKLKEDNTHLQQDISKLRALLAKEKQTNKDLQEQLYTIqGIRRFDPSKAFQH--DSKENiPPKTPFKEG 723
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap