Conserved Protein Domain Family
zf-C2H2_8

?
pfam15909: zf-C2H2_8 
C2H2-type zinc ribbon
This family carries three zinc-fingers in tandem.
Statistics
?
PSSM-Id: 318181
View PSSM: pfam15909
Aligned: 3 rows
Threshold Bit Score: 184.12
Threshold Setting Gi: 612012537
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 125987870 110 PCSSPGCCLSFPSVRDLAQHLRTHCPPT----QSLEGKLFRCSALSCTETFPSMQELVAHSKLHYKPNRYFKCENCLLRF 185
gi 395513430 170 PCSSYGCRLAFPNPRELAQHLHSHLQPT----QSMEGKRFHCSTPSCSETFPSMQELMTHTKLHYKPNRYFKCENCLLRF 245
gi 612012537 216 PCSSYGCRLAFPNPGEXAQHLHSHLQPThfwpYSSTGKLFYCSTASCAESFPSMQELMAHTKLHYKPNRYFKCENCLLRF 295
                         90       100
                 ....*....|....*....|..
gi 125987870 186 RTHRSLFKHLHVCAEHAQSPAP 207
gi 395513430 246 RTHRSLFKHLHVCSDQSHSPAP 267
gi 612012537 296 RTHRSLFKHLHVCSDQSHspap 317
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap