Conserved Protein Domain Family
VIR_N

?
pfam15912: VIR_N 
Virilizer, N-terminal
VIR_N is the conserved N-terminus of the protein virilizer, necessary for male and female viability and required for the production of eggs capable of embryonic development.
Statistics
?
PSSM-Id: 318184
View PSSM: pfam15912
Aligned: 8 rows
Threshold Bit Score: 261.752
Threshold Setting Gi: 808885940
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74948910     6 DGSELLFFDTFSHEEVT-DINLDLVQFPKPVFITQVRIIPLGARVQADFPGGVRLGATNPSKFDLEFFVNDLGMPAASAF 84
gi 160357825    5 SSMELLFLDTFKHPSAEqSSHIDVVRFPCVVYINEVRVIPPGVRAHSGLPDNRAYGETSPHTFQLDLFFNNVSKPSAPVF 84
gi 827541919    5 EKPDLLFFDTFSHDTSE-ELNLDLVQFPKSVYVREIRVIPLGARVEGDFPGRVRLGATNPTKFHIDFFVNDLSKPGASTF 83
gi 321468216   14 DNEELLFFDTFAHGPTE-ELNLDLVQFPKPVYINQVRVIPLGAKVQADFPGGVRLGATNPSQFKLELFVNDLSKPGASAF 92
gi 827541917    5 EKPDLLFFDTFSHDTSE-ELNLDLVQFPKSVYVREIRVIPLGARVEGDFPGRVRLGATNPTKFHIDFFVNDLSKPGASTF 83
gi 528504080    5 SAMELLFLDTFKHQNAE-LTNVDVVRFPYGVLITEVRVIPPGIKAHSNLPDSRAFGETAPHAFQLDLFFNNVSKPNSPVF 83
gi 768921973    5 NSTELLFLDTFKHQNSE--TNVDVVRFPCGVLITEVRVIPPGIKAHTNLPDNRAFGETSPHAFQLDLFFNNLTKPNNPAF 82
gi 808885940    5 ssTELLFLDTFKHQSAE-LTNVDVVRFPCGVLITEVRVIPPGIKAHSNLPDSRAFGETSPHAFQLELFFNNVTKPNNPTF 83
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74948910    85 ENLGLLRYNQNDCIHLDc----SQEKIVTDGLVLRGWYSTITLAIYGIFTNSVTEPIAS--PTL----P-----CEPVGp 149
gi 160357825   85 DRLGSLEYDENTSIIFR-----PNSKVNTDGLVLRGWYNCLTLAIYGSVDRVISHDRDSppPPP----P-----PPPPPq 150
gi 827541919   84 EALGSLDYCQNGQIHMEcgadgDHPRIPTDGLVLRGCYTTITLAVYGTLTQILPETPVGinPPPti-------------- 149
gi 321468216   93 ETLGVLDYNQNSNIHYD-----SDKKVPTDGLVLRGWYTTVTLAVYGVITRAP------------------------IIs 143
gi 827541917   84 EALGSLDYCQNGQIHMEcgadgDHPRIPTDGLVLRGCYTTITLAVYGTLTQILPETPVGinPPPtiqrPavnrdAPP--- 160
gi 528504080   84 DRLGSLEYDENKSIIFR-----PNGKINTDGLVLRGWYTCLTLAVYGTAERPHSHERDSppPPP----P-----PPPqqq 149
gi 768921973   83 NRLGSLEYDENKSIVFR-----PSGKVNTDGLVLRGWYTSLTVAVYGTAERPHGHDQVSspPPP----P-----PPPqqp 148
gi 808885940   84 HRLGSLEYDENKSIVFR-----PSGKVNTDGLVLRGWYTSLTVAVYGTAERSHGHDQGSppPPP----P-----PPPqqp 149
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74948910   150 e---------iaNLSGEVLLQEDVLKDEWQEPMQAellta------hkgnvSDYDP--EDME----YgmsrdhYHQHAEE 208
gi 160357825  151 pqptlkrnlkhaDGEKEDQFNGSPPRPQPRGPRTP----------------PGPPPpdDDED----D------PMSLPVS 204
gi 827541919  150 ----------qrPAVNRDAPPANVTQPPDWNPEPTnpips------ytgnvASTNPd---------------vYTPNTYP 198
gi 321468216  144 i---------ppPPPAAPIKPASPVPVEPAQPPVPelapvftnqiideklrTSTPPfeEKAElikcEn----aFVTSTVV 210
gi 827541917  161 ---------------------ANVTQPPDWNPEPTnpips------ytgnvASTNPd---------------vYTPNTYP 198
gi 528504080  150 qigs--krliklEWENEDQFNGSPPRPQPRGPRTP----------------PGPPPpdDDDE----E------AMPAPGQ 201
gi 768921973  149 ggp---krttkqEWEKDDQYNGSPPRPAPRGPRTP----------------PGPPPpdDDDE----E------QVHVTVG 199
gi 808885940  150 sgp---krivkqEWEKDDQYNGSPPRPAPRGPRTP----------------PGPPPpdDDDE----E------QVQVpga 200
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74948910   209 qEQREMRRLR-RSTHSTDHSPpppRRSHTHSESNDREYIR---CS------Rd-----------KGSRDWSRSPEYSSHR 267
gi 160357825  205 -GDKEEDVPH-REDYFEPISP---DRNSVPQEGQYSDEGE---VE------E------------EPQEEGEDDEDDVDVE 258
gi 827541919  199 --ENYENPIY-RNEYYENEPPk-dPRTYHV--EGDWEKSRdinCEgegdrlR------------RSSRSIERDRDRQGHg 260
gi 321468216  211 -E----------SEVKREDEPe--KETKVKVEEKVVEKVR---EK------S------------RRSDEFTRTRDTSDFR 256
gi 827541917  199 --ENYENPIY-RNEYYENEPPk-dPRTYHV--EGDWE------KS------RdincegegdrlrRSSRSIERDRD-RQGH 259
gi 528504080  202 cPVKVENTEHpGDDYLEPVSP---ERGSLPADETYSDAEQ---ED------D----------------EGPADEEEDDVQ 253
gi 768921973  200 -LVKDESCQG-REDYLEAVSP---ER-SLPADETYSDAEQ---EE------E------------GDEEEEEEQEEEEDAR 252
gi 808885940  201 psqllgnaskkprfvapgpssscllpeskpltpklglsnalekvqkslaapaqskteyeaqpkaaqpatalskalarvlc 280

                  ....*...
gi 74948910   268 SRRKRSER 275
gi 160357825  259 EEEDEDED 266
gi 827541919  261 rrrsmdrr 268
gi 321468216  257 EREWESDR 264
gi 827541917  260 GRRRSMDR 267
gi 528504080  254 SEGTEGDE 261
gi 768921973  253 TEGSAPEE 260
gi 808885940  281 ateskene 288
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap